powered by:
Protein Alignment HmgZ and HMGXB4
DIOPT Version :9
Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006724164.1 |
Gene: | HMGXB4 / 10042 |
HGNCID: | 5003 |
Length: | 603 |
Species: | Homo sapiens |
Alignment Length: | 98 |
Identity: | 31/98 - (31%) |
Similarity: | 53/98 - (54%) |
Gaps: | 14/98 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 GDRPKRP-LSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEY 64
|::||:. :|||.::..|.|..|..|:||....:::|:..|:|:.| |||..|:|||..::.:.
Human 446 GEKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQ 510
Fly 65 NKAVKEYEANGGTDSGAPKKRKKAAAKPAKKAK 97
||| .....|||.::::.:.|.|
Human 511 NKA-----------EATTVKRKASSSEGSMKVK 532
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HmgZ | NP_001286694.1 |
HMG_box |
6..71 |
CDD:395407 |
25/67 (37%) |
HMGXB4 | XP_006724164.1 |
DUF4171 |
150..268 |
CDD:290491 |
|
HMG-box |
450..513 |
CDD:238037 |
22/62 (35%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.