DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and sox17b.2

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001090837.1 Gene:sox17b.2 / 100038235 XenbaseID:XB-GENE-495335 Length:351 Species:Xenopus tropicalis


Alignment Length:104 Identity:23/104 - (22%)
Similarity:51/104 - (49%) Gaps:22/104 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRG--LKDKTEWEQKAIKMKEEYNKA 67
            |.:||::|:|:|..:.|:::.:.||.....:::|..|:.|:.  |..|..:.::|.:::.::.:.
 Frog    35 RIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVKEAERLRVQHIQD 99

  Fly    68 VKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEE 106
            ..:|           |.|.:         :||:...|||
 Frog   100 YPDY-----------KYRPR---------RKKQVKREEE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 14/66 (21%)
sox17b.2NP_001090837.1 SOX-TCF_HMG-box 35..106 CDD:238684 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.