DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and bbx

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_009303743.1 Gene:bbx / 100005540 -ID:- Length:899 Species:Danio rerio


Alignment Length:118 Identity:25/118 - (21%)
Similarity:54/118 - (45%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGDRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEY 64
            |..|.:||::|::|:....|..:::::|........|...:.|..|  |:|.::...|.:.|:.:
Zfish    80 SEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLDPKEKQKYTDMAKEYKDAF 144

  Fly    65 NKAVKEYEANGGTDS-------GAPKKRKKAAAKPAKKAKKKESSEEEEEDES 110
            .||...|:....|:.       .....|||..:.|:..:|....::::.:.:|
Zfish   145 MKANPGYKWCPATNKPVKSPSHSVSNSRKKVWSLPSNPSKDPSVAKKQPKTDS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 15/66 (23%)
bbxXP_009303743.1 SOX-TCF_HMG-box 83..154 CDD:238684 17/70 (24%)
DUF2028 199..344 CDD:312980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.