DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNC3 and Task6

DIOPT Version :10

Sequence 1:NP_004968.2 Gene:KCNC3 / 3748 HGNCID:6235 Length:757 Species:Homo sapiens
Sequence 2:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster


Alignment Length:55 Identity:17/55 - (30%)
Similarity:25/55 - (45%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   494 FWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGV---LTIAMPVPVIVNNFGMY 545
            |::|...:||:|||...|.|..|.|.....|:.|:   |.:...:...||....|
  Fly    84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNC3NP_004968.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
Important for normal N-type inactivation. /evidence=ECO:0000269|PubMed:26997484 1..78
Potassium_chann 1..>18 CDD:431870
BTB_KCNC1_3 89..202 CDD:349721
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..232
Ion_trans 289..550 CDD:459842 17/55 (31%)
Selectivity filter. /evidence=ECO:0000250 503..508 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..613
PHA03247 <637..752 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..746
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 14/47 (30%)
Ion_trans_2 165..243 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.