DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNC3 and Task7

DIOPT Version :10

Sequence 1:NP_004968.2 Gene:KCNC3 / 3748 HGNCID:6235 Length:757 Species:Homo sapiens
Sequence 2:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster


Alignment Length:98 Identity:22/98 - (22%)
Similarity:39/98 - (39%) Gaps:27/98 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   414 RVVRFVRILRIFKLTRHFVGLRVLGHT---LRASTNEFLLLIIFLALGVLIFATMIYYAERIGAD 475
            |:.:|..:  |.:..:...|.|....|   |..:|.  :|..|.:..|..:|:..          
  Fly   132 RLNKFASV--IIRRAKRASGARCTDATEMNLMLATG--MLSSIIITTGAAVFSRY---------- 182

Human   476 PDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGD 508
                  ...:||.:    |::..||:||:|:||
  Fly   183 ------EGWSYFDS----FYYCFVTLTTIGFGD 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
KCNC3NP_004968.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
Important for normal N-type inactivation. /evidence=ECO:0000269|PubMed:26997484 1..78
Potassium_chann 1..>18 CDD:431870
BTB_KCNC1_3 89..202 CDD:349721
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..232
Ion_trans 289..550 CDD:459842 22/98 (22%)
Selectivity filter. /evidence=ECO:0000250 503..508 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..613
PHA03247 <637..752 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..746