DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNC3 and Ork1

DIOPT Version :10

Sequence 1:NP_004968.2 Gene:KCNC3 / 3748 HGNCID:6235 Length:757 Species:Homo sapiens
Sequence 2:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:63/177 - (35%) Gaps:56/177 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   444 STNEFLLLIIFLALGVLIFATMIYY-------------------------AERIG----ADPDDI 479
            |.|.::||:||. :..|:|...|||                         .|.:|    ...|:|
  Fly     2 SPNRWILLLIFY-ISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEI 65

Human   480 LGSNHTY----------FKNIPI------GFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGV 528
            |.....|          :.:.|.      .|::|....:|:|||::.|.|::|.::     :...
  Fly    66 LQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMI-----MIAY 125

Human   529 LTIAMPVPVIV-----NNFGMYYSLAMAKQKLPKKKNKHIPRPPQPG 570
            ..|.:||..|:     ..||..:.....:.|..|........|||.|
  Fly   126 SVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNC3NP_004968.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
Important for normal N-type inactivation. /evidence=ECO:0000269|PubMed:26997484 1..78
Potassium_chann 1..>18 CDD:431870
BTB_KCNC1_3 89..202 CDD:349721
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..232
Ion_trans 289..550 CDD:459842 33/155 (21%)
Selectivity filter. /evidence=ECO:0000250 503..508 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..613 5/15 (33%)
PHA03247 <637..752 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..746
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301 14/65 (22%)
Ion_trans_2 185..266 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.