DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim10 and TIM10

DIOPT Version :9

Sequence 1:NP_611606.1 Gene:Tim10 / 37478 FlyBaseID:FBgn0027360 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_011869.1 Gene:TIM10 / 856395 SGDID:S000003530 Length:93 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:33/76 - (43%)
Similarity:53/76 - (69%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDI 68
            ||:|:  |.|:| ..|.|:::::|::|::.|.|:||||...|||.||.|.|..|:|||||||.:.
Yeast    11 PQLSS--QQKIQ-AAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFET 72

  Fly    69 HEKIGKKLTAM 79
            :.::|:.:..|
Yeast    73 NVQVGENMQKM 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim10NP_611606.1 zf-Tim10_DDP 15..76 CDD:397210 27/60 (45%)
TIM10NP_011869.1 zf-Tim10_DDP 18..80 CDD:397210 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344869
Domainoid 1 1.000 69 1.000 Domainoid score I2302
eggNOG 1 0.900 - - E1_KOG3480
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1670
Isobase 1 0.950 - 0.861654 Normalized mean entropy S553
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003436
OrthoInspector 1 1.000 - - oto99304
orthoMCL 1 0.900 - - OOG6_103064
Panther 1 1.100 - - LDO PTHR11038
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1515
SonicParanoid 1 1.000 - - X2921
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.