DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim10 and TIM10

DIOPT Version :10

Sequence 1:NP_611606.1 Gene:Tim10 / 37478 FlyBaseID:FBgn0027360 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001154540.1 Gene:TIM10 / 817502 AraportID:AT2G29530 Length:107 Species:Arabidopsis thaliana


Alignment Length:74 Identity:26/74 - (35%)
Similarity:40/74 - (54%) Gaps:11/74 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIH 69
            :..|||.:|:..:.|:           :...|..||:..||.|:||..||..||||||:||..::
plant    40 KFETADMSKILRLPEL-----------LAQTCFNKCVDKRYKEAELNMGENSCIDRCVSKYWQVN 93

  Fly    70 EKIGKKLTA 78
            ..:|:.|:|
plant    94 GMVGQLLSA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim10NP_611606.1 zf-Tim10_DDP 15..78 CDD:460764 21/62 (34%)
TIM10NP_001154540.1 zf-Tim10_DDP 14..102 CDD:460764 25/72 (35%)

Return to query results.
Submit another query.