DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim10 and timm10

DIOPT Version :9

Sequence 1:NP_611606.1 Gene:Tim10 / 37478 FlyBaseID:FBgn0027360 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_989294.1 Gene:timm10 / 394912 XenbaseID:XB-GENE-967786 Length:90 Species:Xenopus tropicalis


Alignment Length:76 Identity:55/76 - (72%)
Similarity:68/76 - (89%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIGKKLTAM 79
            ||..|:|:|||:|:|||||.||||||:||.|.|:||.|||.||:||||:|||||||::|||||.:
 Frog     8 QLAAELEVEMMADMYNRMTGACHKKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTEL 72

  Fly    80 SMQDEELMKKM 90
            |:||||||:||
 Frog    73 SLQDEELMRKM 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim10NP_611606.1 zf-Tim10_DDP 15..76 CDD:397210 43/60 (72%)
timm10NP_989294.1 zf-Tim10_DDP 7..69 CDD:397210 43/60 (72%)
Twin CX3C motif 29..54 17/24 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6175
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40845
Inparanoid 1 1.050 129 1.000 Inparanoid score I4520
OMA 1 1.010 - - QHG55396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003436
OrthoInspector 1 1.000 - - otm48048
Panther 1 1.100 - - LDO PTHR11038
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1515
SonicParanoid 1 1.000 - - X2921
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.