DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim10 and TIMM10

DIOPT Version :9

Sequence 1:NP_611606.1 Gene:Tim10 / 37478 FlyBaseID:FBgn0027360 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_036588.1 Gene:TIMM10 / 26519 HGNCID:11814 Length:90 Species:Homo sapiens


Alignment Length:76 Identity:54/76 - (71%)
Similarity:69/76 - (90%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIGKKLTAM 79
            ||..|:|:|||:|:|||||:|||:||:||.|.|:||.|||.||:||||:|||||||::|||||.:
Human     8 QLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTEL 72

  Fly    80 SMQDEELMKKM 90
            |||||||||::
Human    73 SMQDEELMKRV 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim10NP_611606.1 zf-Tim10_DDP 15..76 CDD:397210 42/60 (70%)
TIMM10NP_036588.1 zf-Tim10_DDP 7..69 CDD:397210 42/60 (70%)
Twin CX3C motif 29..54 16/24 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152758
Domainoid 1 1.000 110 1.000 Domainoid score I6309
eggNOG 1 0.900 - - E1_KOG3480
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40845
Inparanoid 1 1.050 128 1.000 Inparanoid score I4679
Isobase 1 0.950 - 0.861654 Normalized mean entropy S553
OMA 1 1.010 - - QHG55396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003436
OrthoInspector 1 1.000 - - oto89233
orthoMCL 1 0.900 - - OOG6_103064
Panther 1 1.100 - - LDO PTHR11038
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1515
SonicParanoid 1 1.000 - - X2921
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.