DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim10 and tim10

DIOPT Version :9

Sequence 1:NP_611606.1 Gene:Tim10 / 37478 FlyBaseID:FBgn0027360 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_593142.1 Gene:tim10 / 2541950 PomBaseID:SPAC222.03c Length:89 Species:Schizosaccharomyces pombe


Alignment Length:60 Identity:32/60 - (53%)
Similarity:46/60 - (76%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIGKKL 76
            |.|.|:|||||::||:...||||||.|:|.|::|.|||.|||||||:||.:.::.:.:.:
pombe    20 MAEQEVEMMSDIFNRLVMTCHKKCISPKYYEADLTKGESVCIDRCVSKYFEANQSLSQHM 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim10NP_611606.1 zf-Tim10_DDP 15..76 CDD:397210 32/58 (55%)
tim10NP_593142.1 zf-Tim10_DDP 17..79 CDD:281019 32/58 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2315
eggNOG 1 0.900 - - E1_KOG3480
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1845
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003436
OrthoInspector 1 1.000 - - oto100881
orthoMCL 1 0.900 - - OOG6_103064
Panther 1 1.100 - - LDO PTHR11038
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1515
SonicParanoid 1 1.000 - - X2921
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.