DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim10 and tim10

DIOPT Version :10

Sequence 1:NP_611606.1 Gene:Tim10 / 37478 FlyBaseID:FBgn0027360 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_593142.1 Gene:tim10 / 2541950 PomBaseID:SPAC222.03C Length:89 Species:Schizosaccharomyces pombe


Alignment Length:60 Identity:32/60 - (53%)
Similarity:46/60 - (76%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIGKKL 76
            |.|.|:|||||::||:...||||||.|:|.|::|.|||.|||||||:||.:.::.:.:.:
pombe    20 MAEQEVEMMSDIFNRLVMTCHKKCISPKYYEADLTKGESVCIDRCVSKYFEANQSLSQHM 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim10NP_611606.1 zf-Tim10_DDP 15..78 CDD:460764 32/60 (53%)
tim10NP_593142.1 zf-Tim10_DDP 17..81 CDD:460764 32/60 (53%)

Return to query results.
Submit another query.