DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim10 and tin-10

DIOPT Version :9

Sequence 1:NP_611606.1 Gene:Tim10 / 37478 FlyBaseID:FBgn0027360 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001370128.1 Gene:tin-10 / 176580 WormBaseID:WBGene00006573 Length:86 Species:Caenorhabditis elegans


Alignment Length:83 Identity:48/83 - (57%)
Similarity:65/83 - (78%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIG 73
            |..|::..:.|:|:|||||:|.||||:|..|||...:.||||.|||.||:|||||||||:|||:|
 Worm     2 ATDAQMAQVAELEVEMMSDMYRRMTNSCQAKCIATAFRESELTKGEAVCLDRCVAKYLDVHEKLG 66

  Fly    74 KKLTAMSMQDEELMKKMS 91
            |:||:||..||..::|::
 Worm    67 KRLTSMSQGDEAALQKIA 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim10NP_611606.1 zf-Tim10_DDP 15..76 CDD:397210 39/60 (65%)
tin-10NP_001370128.1 zf-Tim10_DDP 11..69 CDD:397210 39/57 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162616
Domainoid 1 1.000 96 1.000 Domainoid score I4605
eggNOG 1 0.900 - - E1_KOG3480
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40845
Inparanoid 1 1.050 109 1.000 Inparanoid score I3463
Isobase 1 0.950 - 0.861654 Normalized mean entropy S553
OMA 1 1.010 - - QHG55396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003436
OrthoInspector 1 1.000 - - oto17988
orthoMCL 1 0.900 - - OOG6_103064
Panther 1 1.100 - - LDO PTHR11038
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1515
SonicParanoid 1 1.000 - - X2921
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.780

Return to query results.
Submit another query.