DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10307 and Lap1

DIOPT Version :9

Sequence 1:NP_001286690.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster


Alignment Length:293 Identity:82/293 - (27%)
Similarity:141/293 - (48%) Gaps:33/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNYVLANCEDAI--YKKAFSLNLSHYQISDVPGIIEKCETLMKLFLNQNKLTKIPSSIGSLMRLQ 72
            |..::.|..:.|  .|....|:||...:..:|..|....:|.:|.||:..|..:|::.|.|:.|:
  Fly    94 NRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQELLLNETYLEFLPANFGRLVNLR 158

  Fly    73 VLTLDYNKLDEFPLCICRLVRLKFLNISCNNISSLPPELGYLTQLETFWCN-------------- 123
            :|.|..|.|...|..:.||:.|:.|:|..|..:.||..:|.|..|...|.:              
  Fly   159 ILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKL 223

  Fly   124 --------NTGLLE-LPNEIRNCEHLETLGVRGNPLKKLPDAIGALSSLRWLTAEGCELSEVPLT 179
                    |..||: ||:|:.|..::|.|.:..|.|:..|.::|.|.||.....|...|:|:|.:
  Fly   224 RDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDS 288

  Fly   180 MALLGNLVHLNLKGNRLRRLPRMLMAMQKLRFAFLNENCIDEMPTRSQLEELRTLHMLNLSKNPI 244
            ::.|..|..|.|..|:|.|||..:..::.|||.|.::|.:.::|  .:|...:.|.:|:::.|.:
  Fly   289 ISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLP--DELCSCQQLSVLSVANNQL 351

  Fly   245 S-LHRDL----QLMALRQTNLYVE-LPSDPANI 271
            | |.:::    ::..|...|.|:. ||....|:
  Fly   352 SALPQNIGNLSKMKVLNVVNNYINALPVSMLNL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10307NP_001286690.1 leucine-rich repeat 27..44 CDD:275380 5/16 (31%)
LRR_8 47..104 CDD:290566 20/56 (36%)
leucine-rich repeat 48..70 CDD:275380 8/21 (38%)
LRR 69..>244 CDD:227223 57/197 (29%)
leucine-rich repeat 71..93 CDD:275380 8/21 (38%)
leucine-rich repeat 94..116 CDD:275380 8/21 (38%)
leucine-rich repeat 117..139 CDD:275380 9/44 (20%)
leucine-rich repeat 140..162 CDD:275380 7/21 (33%)
leucine-rich repeat 163..185 CDD:275380 6/21 (29%)
leucine-rich repeat 186..208 CDD:275380 8/21 (38%)
leucine-rich repeat 209..233 CDD:275380 7/23 (30%)
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 32/105 (30%)
leucine-rich repeat 21..41 CDD:275380
LRR_8 40..98 CDD:290566 1/3 (33%)
leucine-rich repeat 42..64 CDD:275380
leucine-rich repeat 65..87 CDD:275380
LRR_8 86..140 CDD:290566 11/45 (24%)
leucine-rich repeat 88..110 CDD:275380 3/15 (20%)
leucine-rich repeat 111..133 CDD:275380 5/21 (24%)
leucine-rich repeat 134..156 CDD:275380 8/21 (38%)
LRR_8 156..213 CDD:290566 18/56 (32%)
leucine-rich repeat 157..179 CDD:275380 8/21 (38%)
leucine-rich repeat 180..202 CDD:275380 8/21 (38%)
leucine-rich repeat 203..225 CDD:275380 2/21 (10%)
leucine-rich repeat 226..248 CDD:275380 7/21 (33%)
leucine-rich repeat 272..294 CDD:275380 6/21 (29%)
LRR_8 279..328 CDD:290566 17/48 (35%)
leucine-rich repeat 295..317 CDD:275380 8/21 (38%)
leucine-rich repeat 318..340 CDD:275380 7/23 (30%)
LRR_8 340..396 CDD:290566 11/45 (24%)
leucine-rich repeat 364..386 CDD:275380 6/21 (29%)
PDZ_signaling 770..846 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.