DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10307 and Pidd1

DIOPT Version :10

Sequence 1:NP_611605.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001099788.2 Gene:Pidd1 / 293625 RGDID:1311792 Length:917 Species:Rattus norvegicus


Alignment Length:212 Identity:65/212 - (30%)
Similarity:100/212 - (47%) Gaps:10/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HYQISDVPGIIEKCETLMKLFLNQNKLTKIPSSIGSLMRLQVLTLDYNKLDEFPLCICRLVRLKF 96
            |..::.:|..:.....|..|.|:.|:|..:|:.:..|..|..|.|.:|.|.|.|..:..|..|.|
  Rat   116 HGTLTTLPASMRDLACLAHLDLSFNRLETLPTCVLELHSLDALLLSHNCLSELPEALGALPTLTF 180

  Fly    97 LNISCNNISSLPPELGYLTQLETFWCNNTGLLELPNEIRNCEHLETLGVRGNPLKKLPDAIGALS 161
            |.::.|.:..|||.||.|:.|:....:...|..:|:||.:...|..|.:..|.|:.||.::..|.
  Rat   181 LTVTHNLLERLPPTLGSLSTLQRLDLSENLLDTIPSEIGDLSSLRELNLASNRLQHLPASLAGLR 245

  Fly   162 SLRWLTAEGCELSEVPLTMALLGNLVHLNLKGNRLRRLPRMLMAMQKLRFAFLNENCIDEM---- 222
            |||.|......|:.||..:|.|..:..|:|:.|:||.||..|:   ...|..|..|.:.|.    
  Rat   246 SLRLLVLHSNLLTSVPPGLAHLPLITRLDLRDNQLRDLPAELL---DAPFVRLQGNPLGEASPAP 307

  Fly   223 ---PTRSQLEELRTLHM 236
               |..||:.|:..|.:
  Rat   308 PSPPDISQVPEMPRLFL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10307NP_611605.1 leucine-rich repeat 27..44 CDD:275380 2/11 (18%)
LRR <39..>276 CDD:443914 64/205 (31%)
leucine-rich repeat 48..70 CDD:275380 7/21 (33%)
leucine-rich repeat 71..93 CDD:275380 8/21 (38%)
leucine-rich repeat 94..116 CDD:275380 10/21 (48%)
leucine-rich repeat 117..139 CDD:275380 5/21 (24%)
leucine-rich repeat 140..162 CDD:275380 7/21 (33%)
leucine-rich repeat 163..185 CDD:275380 8/21 (38%)
leucine-rich repeat 186..208 CDD:275380 8/21 (38%)
leucine-rich repeat 209..233 CDD:275380 8/30 (27%)
Pidd1NP_001099788.2 LRR <128..>300 CDD:443914 57/174 (33%)
leucine-rich repeat 132..154 CDD:275380 7/21 (33%)
leucine-rich repeat 155..177 CDD:275380 8/21 (38%)
leucine-rich repeat 178..200 CDD:275380 10/21 (48%)
leucine-rich repeat 201..223 CDD:275380 5/21 (24%)
leucine-rich repeat 224..246 CDD:275380 7/21 (33%)
leucine-rich repeat 247..269 CDD:275380 8/21 (38%)
leucine-rich repeat 270..289 CDD:275380 8/21 (38%)
ZU5 330..>403 CDD:470600
Peptidase_S68 428..460 CDD:463098
ZU5 471..544 CDD:470600
Death_PIDD 795..880 CDD:260049
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.