DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10307 and cyr1

DIOPT Version :10

Sequence 1:NP_611605.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_596159.1 Gene:cyr1 / 2540810 PomBaseID:SPBC19C7.03 Length:1692 Species:Schizosaccharomyces pombe


Alignment Length:283 Identity:75/283 - (26%)
Similarity:124/283 - (43%) Gaps:68/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNYV--------LANCEDAIYKKAFSLNLSHYQISDVPGIIEKCETLMKLFLNQNKLT-KIPSSI 65
            ||:|        |:..|        :||.||..:|.:...|.....|..|:|..|.|: ::|..|
pombe   535 NNFVTFPLIITELSQLE--------TLNFSHNLLSQISSKIGSLVKLKHLYLQFNDLSNRLPQEI 591

  Fly    66 GSLMRLQVLTLDYN------KLDEFPLCICRLVRLKFLNISCNNIS------------------- 105
            |.|..|:.:.|.||      .|.|.|       :|..:|::||.:|                   
pombe   592 GLLKNLETIDLSYNAITNIASLSECP-------KLNSINVACNLLSFYEYSNPSATFIDFSFCPL 649

  Fly   106 -SLPPELGYLTQLETFWCNNTGLLELPNE-IRNCEHLETLGVRGNPLKKLPDAIGALSSLRWLTA 168
             ::.|...| :.|..|..::..|:.|.:. |....::||:.|..|....:.|||.|:.:|::|:.
pombe   650 TTIDPAFSY-SNLVYFDISHAKLIGLKDSVIETLVNVETVKVNYNHFTSISDAISAMQNLKYLSC 713

  Fly   169 EGCELSEVPLTMALLGNLVHLNLKGNRLRRLPRMLMAMQKLRFAFLNENCIDEMP---------- 223
            ..||:|.|...:..|.:||||:|..|.::..|..:..:..|:...|:.|.::::.          
pombe   714 TNCEMSYVSPNLGKLKHLVHLDLHANNIKIFPEEVWQVSSLKVVNLSSNILEKIKLPVATSKKLT 778

  Fly   224 -TRSQLEELRTLHMLNLSKNPIS 245
             |.|||:.:||     ||.||:|
pombe   779 RTISQLKIMRT-----LSGNPVS 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10307NP_611605.1 leucine-rich repeat 27..44 CDD:275380 6/16 (38%)
LRR <39..>276 CDD:443914 65/246 (26%)
leucine-rich repeat 48..70 CDD:275380 9/22 (41%)
leucine-rich repeat 71..93 CDD:275380 7/27 (26%)
leucine-rich repeat 94..116 CDD:275380 7/41 (17%)
leucine-rich repeat 117..139 CDD:275380 5/22 (23%)
leucine-rich repeat 140..162 CDD:275380 8/21 (38%)
leucine-rich repeat 163..185 CDD:275380 7/21 (33%)
leucine-rich repeat 186..208 CDD:275380 7/21 (33%)
leucine-rich repeat 209..233 CDD:275380 7/34 (21%)
cyr1NP_596159.1 Ad_cyc_g-alpha 155..200 CDD:129025
RA_CYR1_like 294..391 CDD:340734
leucine-rich repeat 409..430 CDD:275380
LRR 430..>711 CDD:443914 48/191 (25%)
leucine-rich repeat 431..454 CDD:275380
leucine-rich repeat 455..477 CDD:275380
leucine-rich repeat 478..503 CDD:275380
leucine-rich repeat 504..526 CDD:275380
leucine-rich repeat 527..549 CDD:275380 4/13 (31%)
leucine-rich repeat 550..572 CDD:275380 7/29 (24%)
leucine-rich repeat 573..596 CDD:275380 9/22 (41%)
LRR 589..990 CDD:443914 58/221 (26%)
leucine-rich repeat 597..618 CDD:275380 7/27 (26%)
leucine-rich repeat 661..684 CDD:275380 5/22 (23%)
leucine-rich repeat 685..707 CDD:275380 8/21 (38%)
leucine-rich repeat 708..730 CDD:275380 7/21 (33%)
leucine-rich repeat 754..783 CDD:275380 4/28 (14%)
leucine-rich repeat 784..807 CDD:275380 8/18 (44%)
leucine-rich repeat 808..831 CDD:275380
leucine-rich repeat 832..855 CDD:275380
leucine-rich repeat 856..877 CDD:275380
leucine-rich repeat 879..901 CDD:275380
leucine-rich repeat 902..930 CDD:275380
PP2C 1032..1268 CDD:395385
Guanylate_cyc 1323..1519 CDD:425528
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.