DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10307 and Lrrd1

DIOPT Version :10

Sequence 1:NP_611605.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_766467.2 Gene:Lrrd1 / 242838 MGIID:3045299 Length:853 Species:Mus musculus


Alignment Length:273 Identity:77/273 - (28%)
Similarity:126/273 - (46%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNLSHYQISDVPGIIEKCETLMKLFLN-----------------------QNKLTKIPSSIGSLM 69
            ||.|:.:||.:|..:.:.|.:.:|.||                       :|.||.||.|:.||.
Mouse   210 LNASYNEISQIPKELLQLENMRQLLLNSNHIDTLPSGLEHLRYLETLSLGKNMLTYIPDSLSSLK 274

  Fly    70 RLQVLTLDYNKLDEFPLCICRLVRLKFLNISCNNISSLPPELGYLTQLETFWCNNTGLLELPNEI 134
            .|::|.|:||:|..|...:|.|.:|..||::.|.|.|||.|:..|..||:...::..|..|..||
Mouse   275 NLRILNLEYNQLTIFSKSLCFLPKLNSLNLTGNMIGSLPKEVRELKNLESLLMDHNKLTFLAVEI 339

  Fly   135 RNCEHLETLGVRGNPLKKLPDAIGALSSLRWLTAEGCELSEVPLTMALLGNLVHLNLKGNRLRRL 199
            .....::.|.:..|.|:.:...|.....||.|..:...|..:|..::...||..|:|..|.:..|
Mouse   340 FQLPKIKELHLADNKLEAISPKIENFKELRLLNLDKNLLQSIPKKISHCVNLESLSLSDNNIEEL 404

  Fly   200 PRMLMAMQKLRFAFLNENCIDEMPTRSQLEELRTLHMLNLSKNPISLHRDLQLMALRQTNLYVEL 264
            |:.:..::.||...:|.|.:..|  ..::..|..:|:|..|.|.|: |..:::...|:.. .|||
Mouse   405 PKKIRKLKNLRQLHVNRNKMITM--TEEISHLSNIHILEFSGNQIT-HVPIEIKNCRKIT-RVEL 465

  Fly   265 PSD-----PANIC 272
            ..:     |..:|
Mouse   466 NYNNIMYFPVGLC 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10307NP_611605.1 leucine-rich repeat 27..44 CDD:275380 6/15 (40%)
LRR <39..>276 CDD:443914 72/262 (27%)
leucine-rich repeat 48..70 CDD:275380 11/44 (25%)
leucine-rich repeat 71..93 CDD:275380 9/21 (43%)
leucine-rich repeat 94..116 CDD:275380 10/21 (48%)
leucine-rich repeat 117..139 CDD:275380 6/21 (29%)
leucine-rich repeat 140..162 CDD:275380 4/21 (19%)
leucine-rich repeat 163..185 CDD:275380 5/21 (24%)
leucine-rich repeat 186..208 CDD:275380 6/21 (29%)
leucine-rich repeat 209..233 CDD:275380 6/23 (26%)
Lrrd1NP_766467.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78
LRR 1 133..157
leucine-rich repeat 139..159 CDD:275380
PLN03150 <140..224 CDD:178695 6/13 (46%)
LRR 2 159..180
leucine-rich repeat 160..183 CDD:275380
LRR 3 183..204
leucine-rich repeat 184..206 CDD:275380
LRR 4 206..227 6/16 (38%)
PLN00113 207..>678 CDD:215061 77/273 (28%)
leucine-rich repeat 207..229 CDD:275380 6/18 (33%)
LRR 5 229..251 3/21 (14%)
leucine-rich repeat 230..252 CDD:275380 3/21 (14%)
LRR 6 252..274 7/21 (33%)
leucine-rich repeat 253..275 CDD:275380 8/21 (38%)
LRR 7 275..297 8/21 (38%)
leucine-rich repeat 276..298 CDD:275380 9/21 (43%)
LRR 8 298..319 9/20 (45%)
leucine-rich repeat 299..321 CDD:275380 10/21 (48%)
LRR 9 321..342 6/20 (30%)
leucine-rich repeat 322..344 CDD:275380 6/21 (29%)
LRR 10 344..365 4/20 (20%)
leucine-rich repeat 345..367 CDD:275380 4/21 (19%)
LRR 11 367..388 5/20 (25%)
leucine-rich repeat 368..390 CDD:275380 5/21 (24%)
LRR 12 390..411 7/20 (35%)
leucine-rich repeat 391..436 CDD:275380 12/46 (26%)
LRR 13 413..435 5/23 (22%)
LRR 14 436..457 6/21 (29%)
LRR 15 459..481 5/21 (24%)
leucine-rich repeat 460..482 CDD:275380 5/20 (25%)
LRR 16 482..503
leucine-rich repeat 483..505 CDD:275380
LRR 17 505..527
leucine-rich repeat 506..528 CDD:275380
LRR 18 528..549
LRR 19 551..573
leucine-rich repeat 552..574 CDD:275380
LRR 20 574..596
leucine-rich repeat 575..597 CDD:275380
LRR 21 597..618
leucine-rich repeat 598..620 CDD:275380
LRR 22 620..641
leucine-rich repeat 621..646 CDD:275380
PLN03150 <637..726 CDD:178695
LRR 23 646..668
leucine-rich repeat 647..669 CDD:275380
LRR 24 669..690
leucine-rich repeat 670..692 CDD:275380
LRR 25 692..713
LRR 26 715..736
leucine-rich repeat 716..736 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.