DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10307 and lrrc47

DIOPT Version :10

Sequence 1:NP_611605.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001120634.1 Gene:lrrc47 / 100145802 XenbaseID:XB-GENE-967812 Length:570 Species:Xenopus tropicalis


Alignment Length:229 Identity:67/229 - (29%)
Similarity:103/229 - (44%) Gaps:31/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEDAIYKKAFSLNLSHYQISDVPGIIEKCET---------LMKLFLNQNKLTKIPSSIGSLMRLQ 72
            |...:..:.|||.|.:|  .:|.|..|..|.         |..|.|.:|||..:..::|.|..|:
 Frog    37 CAGQLPSQLFSLTLLNY--LEVSGCSELREVSPGLGRLIHLQNLVLCRNKLRLLSPAVGQLSALR 99

  Fly    73 VLTLDYNKLDEFPLCICRLVRLKFLNISCNNISSLPPELGYLTQLETFWCNNTGLLELPNEI--R 135
            :|.:..|:|:..|..:|.|..|..:|:|||.:..|||.|...|:|.....:...:..||..:  |
 Frog   100 LLDVSGNQLEVLPAELCGLPELCTINVSCNQLQELPPGLERCTKLAELNLSRNRICALPPGLLCR 164

  Fly   136 NCEHLETLGVRGNPLKKLPDAIGALSSLRWLTAEGCELSEVPLTMALLGNLVHLNLKGNRL--RR 198
            ....|.:|....|.:::|...||.|..|:.|......|:::|..:|....|..:|.|||:|  :|
 Frog   165 QLPLLASLSAADNQIQELGGDIGLLPGLKSLDLSNNLLTDIPYELADCSKLKDINFKGNKLKDKR 229

  Fly   199 LPRMLMAMQKLRFAFLNENCIDEMPTRSQLEELR 232
            |.:|:...|                |:|.||.||
 Frog   230 LEKMVNGCQ----------------TKSVLEYLR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10307NP_611605.1 leucine-rich repeat 27..44 CDD:275380 6/16 (38%)
LRR <39..>276 CDD:443914 60/207 (29%)
leucine-rich repeat 48..70 CDD:275380 8/21 (38%)
leucine-rich repeat 71..93 CDD:275380 7/21 (33%)
leucine-rich repeat 94..116 CDD:275380 9/21 (43%)
leucine-rich repeat 117..139 CDD:275380 4/23 (17%)
leucine-rich repeat 140..162 CDD:275380 7/21 (33%)
leucine-rich repeat 163..185 CDD:275380 5/21 (24%)
leucine-rich repeat 186..208 CDD:275380 9/23 (39%)
leucine-rich repeat 209..233 CDD:275380 6/24 (25%)
lrrc47NP_001120634.1 LRR <45..>232 CDD:443914 58/188 (31%)
leucine-rich repeat 51..74 CDD:275380 5/24 (21%)
leucine-rich repeat 75..97 CDD:275380 8/21 (38%)
leucine-rich repeat 98..120 CDD:275380 7/21 (33%)
leucine-rich repeat 121..143 CDD:275380 9/21 (43%)
leucine-rich repeat 144..168 CDD:275380 4/23 (17%)
leucine-rich repeat 169..191 CDD:275380 7/21 (33%)
leucine-rich repeat 192..214 CDD:275380 5/21 (24%)
PLN02265 313..>501 CDD:215149
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.