DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbp and SPT15

DIOPT Version :9

Sequence 1:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_011075.3 Gene:SPT15 / 856891 SGDID:S000000950 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:146/182 - (80%)
Similarity:165/182 - (90%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMV 234
            ||..||||.|||||:||.|.|:||||.:||||||||||||||||||||||||:||||||:|||||
Yeast    58 SATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV 122

  Fly   235 CTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEP 299
            .|||||||||:||:|||||||||:||.|||.||||||:|||||||||||||||..:|..||||||
Yeast   123 VTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEP 187

  Fly   300 ELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKK 351
            |||||||||||:|:||||||||||:||||||.|:|||.||:.|:|:|.:|:|
Yeast   188 ELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbpNP_523805.1 PLN00062 176..351 CDD:177693 141/174 (81%)
TBP_eukaryotes 176..349 CDD:239952 140/172 (81%)
SPT15NP_011075.3 PLN00062 64..239 CDD:177693 141/174 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I1020
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 296 1.000 Inparanoid score I513
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 1 1.000 - - oto99529
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - LDO PTHR10126
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1482
SonicParanoid 1 1.000 - - X1201
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.