DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbp and TBP1

DIOPT Version :9

Sequence 1:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_187953.1 Gene:TBP1 / 820546 AraportID:AT3G13445 Length:200 Species:Arabidopsis thaliana


Alignment Length:178 Identity:145/178 - (81%)
Similarity:161/178 - (90%) Gaps:0/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGA 238
            ||||.||||||||||.||||||.|||.|||||||||||||||||||||:||||||:|||||||||
plant    20 GIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGA 84

  Fly   239 KSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFP 303
            ||||.|::||||||||:|||||||||.||||||:|||||||||||||||..:|..||||||||||
plant    85 KSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFP 149

  Fly   304 GLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKK 351
            ||||||..|:||||||||||:|:||||:|.|.|.||:.|:|:|.:|:|
plant   150 GLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbpNP_523805.1 PLN00062 176..351 CDD:177693 142/174 (82%)
TBP_eukaryotes 176..349 CDD:239952 141/172 (82%)
TBP1NP_187953.1 PLN00062 22..200 CDD:177693 143/176 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1551
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 294 1.000 Inparanoid score I814
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 1 1.000 - - otm3311
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1201
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.