DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbp and Tbpl1

DIOPT Version :9

Sequence 1:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_038947216.1 Gene:Tbpl1 / 689030 RGDID:1597456 Length:238 Species:Rattus norvegicus


Alignment Length:139 Identity:62/139 - (44%)
Similarity:90/139 - (64%) Gaps:1/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 CKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARI 254
            |.|:|:||||...|..|. :....|:|::|:||.||.|:||||::||||.||::::..||:.||.
  Rat    44 CHLNLRKIALEGANVIYK-RDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARRLARS 107

  Fly   255 IQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIF 319
            :|||||...|.|||:.|::..|::.|.|||......:...:||||||.|.:.||:...|..|.||
  Rat   108 LQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIF 172

  Fly   320 VSGKVVLTG 328
            .:|.:.:||
  Rat   173 STGSITVTG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbpNP_523805.1 PLN00062 176..351 CDD:177693 62/139 (45%)
TBP_eukaryotes 176..349 CDD:239952 62/139 (45%)
Tbpl1XP_038947216.1 TLF 41..232 CDD:239953 62/139 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.