DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbp and Trf4

DIOPT Version :9

Sequence 1:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster


Alignment Length:161 Identity:36/161 - (22%)
Similarity:68/161 - (42%) Gaps:1/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 CKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARI 254
            |:..:.::.|....:.::|....:|:::|..|.....|.:.||:..| |.:.|.:|....|..||
  Fly   134 CRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFKVIRI 197

  Fly   255 IQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIF 319
            :|.|.:....::|....:..|..:.|.|.|:.:...|....:......|.:.|......:...:|
  Fly   198 LQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVF 262

  Fly   320 VSGKVVLTGAKVRQEIYDAFDKIFPILKKFK 350
            .:|.|::..:....|..:|.....|||.|.|
  Fly   263 PTGFVLVLHSTSHCETREAIANFLPILAKLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbpNP_523805.1 PLN00062 176..351 CDD:177693 36/161 (22%)
TBP_eukaryotes 176..349 CDD:239952 34/158 (22%)
Trf4NP_608699.1 TBP 128..200 CDD:278767 16/66 (24%)
PLN00062 131..294 CDD:177693 36/161 (22%)
TBP 213..291 CDD:278767 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439828
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.