DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbp and Trf2

DIOPT Version :9

Sequence 1:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster


Alignment Length:317 Identity:94/317 - (29%)
Similarity:155/317 - (48%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DSLMPAPGSSSVQHQQQQQQSD----ASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQQL 102
            |:::.|.||.::.....:.:::    ||.|:||...:..| |..:.|||. .......:::::..
  Fly  1195 DTIVLATGSKNMFLTSSENKANLPTVASNGNGLITAKMDL-LEEEVMQSI-TVIDDDDEEKKEVA 1257

  Fly   103 QSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDALSNIHQTMGPSTPMTPAT 167
            :.:......:.|..:.||                            ...|.|:.           
  Fly  1258 EDEEESSNNAKPIDLHQP----------------------------IADNEHEL----------- 1283

  Fly   168 PGSADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGK 232
                  .||  :.|:|.:.::.|.|.|::|||...|.||. :....|.|::|.|.|||.|:|||:
  Fly  1284 ------DIV--INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIWSSGR 1339

  Fly   233 MVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSY 297
            :.||||.||..:::|||:|||.:.|||||.:||:|:|.|::|:|.:.:.|::......|...:||
  Fly  1340 ITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASY 1404

  Fly   298 EPELFPGLIYRM--VRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQ 352
            ||||.||:.|:|  ..|:..|.||.:|.|.:|.|.| ..:..|...|:|::..|:||
  Fly  1405 EPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYPLVFDFRKQ 1460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbpNP_523805.1 PLN00062 176..351 CDD:177693 72/176 (41%)
TBP_eukaryotes 176..349 CDD:239952 71/174 (41%)
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 72/193 (37%)
PLN00062 1285..1459 CDD:177693 73/177 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.