DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbp and tbp1

DIOPT Version :9

Sequence 1:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_594566.1 Gene:tbp1 / 2541582 PomBaseID:SPAC29E6.08 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:150/207 - (72%)
Similarity:171/207 - (82%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PMTP-----ATPGSAD------------PGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPK 209
            |:.|     ||..:||            .||||.|||||:||||.|:||||.|||||||||||||
pombe    24 PVLPNANNEATNETADSGDAEVSKNEGVSGIVPTLQNIVATVNLDCRLDLKTIALHARNAEYNPK 88

  Fly   210 RFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVG 274
            ||||||||||||::|||||:|||||..|.||||||:||:||||||||||||.|||.||||||:||
pombe    89 RFAAVIMRIREPKSTALIFASGKMVVLGGKSEDDSKLASRKYARIIQKLGFNAKFTDFKIQNIVG 153

  Fly   275 SCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAF 339
            |||||||||||||..:|..|||||||||||||||||:|::|||||||||:||||||||:|||.||
pombe   154 SCDVKFPIRLEGLAYSHGTFSSYEPELFPGLIYRMVKPKVVLLIFVSGKIVLTGAKVREEIYQAF 218

  Fly   340 DKIFPILKKFKK 351
            :.|:|:|.:|:|
pombe   219 EAIYPVLSEFRK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbpNP_523805.1 PLN00062 176..351 CDD:177693 141/174 (81%)
TBP_eukaryotes 176..349 CDD:239952 140/172 (81%)
tbp1NP_594566.1 PLN00062 55..230 CDD:177693 141/174 (81%)
TBP_eukaryotes 55..228 CDD:239952 140/172 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1178
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 293 1.000 Inparanoid score I623
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001202
OrthoInspector 1 1.000 - - oto101151
orthoMCL 1 0.900 - - OOG6_100597
Panther 1 1.100 - - LDO PTHR10126
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1482
SonicParanoid 1 1.000 - - X1201
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.