DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbp and Tbpl1

DIOPT Version :9

Sequence 1:NP_523805.1 Gene:Tbp / 37476 FlyBaseID:FBgn0003687 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_035733.1 Gene:Tbpl1 / 237336 MGIID:1339946 Length:186 Species:Mus musculus


Alignment Length:174 Identity:69/174 - (39%)
Similarity:108/174 - (62%) Gaps:2/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDD 243
            :.|:|......|.|:|:||||...|..|. :....|:|::|:||.||.|:||||::||||.||::
Mouse    13 ITNVVCVFRTRCHLNLRKIALEGANVIYK-RDVGKVLMKLRKPRITATIWSSGKIICTGATSEEE 76

  Fly   244 SRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYR 308
            ::..||:.||.:|||||...|.|||:.|::..|::.|.|||......:...:||||||.|.:.||
Mouse    77 AKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYR 141

  Fly   309 MVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQ 352
            :...|..|.||.:|.:.:||..|: .:..|.::|:|.:.:.:|:
Mouse   142 IKSLRATLQIFSTGSITVTGPNVK-AVATAVEQIYPFVFESRKE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbpNP_523805.1 PLN00062 176..351 CDD:177693 68/171 (40%)
TBP_eukaryotes 176..349 CDD:239952 68/169 (40%)
Tbpl1NP_035733.1 TLF 9..180 CDD:239953 68/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.