DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stum and Stum

DIOPT Version :9

Sequence 1:NP_001261125.2 Gene:stum / 37473 FlyBaseID:FBgn0050263 Length:1870 Species:Drosophila melanogaster
Sequence 2:NP_001074696.1 Gene:Stum / 381310 MGIID:2138735 Length:141 Species:Mus musculus


Alignment Length:130 Identity:38/130 - (29%)
Similarity:55/130 - (42%) Gaps:18/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1708 KRRESNARRQSIRAPPP-SEDTRKKLHVDLVEYSSKMKGAIPVLPLYLAWFCAFCNVVFPGLGTL 1771
            |..|:.|...::.|..| ...:...:.|.:.|....::.|||.:|..:|..|.|.|...|||||.
Mouse     6 KDAETAAAAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTF 70

  Fly  1772 LSGLFCLCVGIPRFSQFDSARARIGS------FIINIIVAVSQFFCVLFCFVGWGWSIWWGTIML 1830
            :|....||          .||..:..      |.:||..|:.|....: ..|||..||:||..|:
Mouse    71 VSAFTVLC----------GARTDLPDRHVCCVFWLNIAAALIQVLTAI-VMVGWIMSIFWGMDMV 124

  Fly  1831  1830
            Mouse   125  124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stumNP_001261125.2 Spec3 1745..1833 CDD:292423 31/92 (34%)
StumNP_001074696.1 Spec3 44..127 CDD:406276 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006255
OrthoInspector 1 1.000 - - oto92736
orthoMCL 1 0.900 - - OOG6_107069
Panther 1 1.100 - - O PTHR21676
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4276
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.