DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stum and Y51H7BR.7

DIOPT Version :9

Sequence 1:NP_001261125.2 Gene:stum / 37473 FlyBaseID:FBgn0050263 Length:1870 Species:Drosophila melanogaster
Sequence 2:NP_493985.3 Gene:Y51H7BR.7 / 173527 WormBaseID:WBGene00021778 Length:151 Species:Caenorhabditis elegans


Alignment Length:114 Identity:37/114 - (32%)
Similarity:59/114 - (51%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1723 PPSEDTRKKLHVDLVEYSSKMKGAIPVLPLYLAWFCAFCNVVFPGLGTLLSGLFCLCVGIPRFSQ 1787
            |.|....:|......::....:..||::||.||..|.|.|::.|||||..:.|..||..      
 Worm    25 PQSRTEHEKTSAFGYQHHGFFRAEIPIMPLSLAVLCCFLNMLIPGLGTFWAALSVLCCS------ 83

  Fly  1788 FDSAR-ARIGSFIINIIVAVSQFFCVLF-CFVGWGWSIWWGTIMLRCAK 1834
             ||.| :....|::|::.|:.||  :|| ..||:.||:.||.:.::.|:
 Worm    84 -DSGRSSTFRCFMVNLLAAMLQF--LLFPILVGFLWSVIWGIMFIQIAR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stumNP_001261125.2 Spec3 1745..1833 CDD:292423 33/89 (37%)
Y51H7BR.7NP_493985.3 Spec3 47..128 CDD:406276 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21676
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4276
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.