DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stum and stum

DIOPT Version :9

Sequence 1:NP_001261125.2 Gene:stum / 37473 FlyBaseID:FBgn0050263 Length:1870 Species:Drosophila melanogaster
Sequence 2:XP_002941176.2 Gene:stum / 100490899 XenbaseID:XB-GENE-6052376 Length:128 Species:Xenopus tropicalis


Alignment Length:103 Identity:33/103 - (32%)
Similarity:45/103 - (43%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1734 VDLVEYSSKMKGAIPVLPLYLAWFCAFCNVVFPGLGTLLSGLFCLCVGIPRFSQFDSARARIGS- 1797
            |.:.|....::.|||.:|..:|..|.|.|...|||||.:|....||          .||..:.. 
 Frog    20 VQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTFVSAFTVLC----------GARTDLPDR 74

  Fly  1798 -----FIINIIVAVSQFFCVLFCFVGWGWSIWWGTIML 1830
                 |.:||..|:.|....: ..|||..||:||..|:
 Frog    75 HMCCVFWLNIAAALIQILTAI-VMVGWIMSIFWGMDMV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stumNP_001261125.2 Spec3 1745..1833 CDD:292423 31/92 (34%)
stumXP_002941176.2 Spec3 31..114 CDD:374119 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006255
OrthoInspector 1 1.000 - - oto103020
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.