DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2alpha and Drap1

DIOPT Version :9

Sequence 1:NP_611601.2 Gene:NC2alpha / 37471 FlyBaseID:FBgn0034650 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001278009.1 Gene:Drap1 / 66556 MGIID:1913806 Length:212 Species:Mus musculus


Alignment Length:222 Identity:90/222 - (40%)
Similarity:120/222 - (54%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSKKKKYNARFPAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTL 65
            |||||||||||||..|||||||:||||||||.||||||||.||||:||||.|..::|.:|||||:
Mouse     1 MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTM 65

  Fly    66 SPSHMRQCIVSEKRFDFLKELVRNIPDISVAEEAAYNEDDVLRSSPEEQYPDSDT-PYDLSLPST 129
            :.||::|||..|::|||||:||.::||              ::...|:.:.|.|. |...::||.
Mouse    66 TTSHLKQCIELEQQFDFLKDLVASVPD--------------MQGDGEDNHVDGDKGPRRWTVPSR 116

  Fly   130 SMRSQANGTAAYMRSMSLNNGAGSGGGAAATKRQFQSQHSTQETPTTSTTLPAKLARSGSMPAYT 194
            ..|...:       |...|.|.||.|    ..::.....|.||..:..|....:    ...|...
Mouse   117 RGRKPGS-------SGRKNGGTGSKG----KDKKLSGTDSEQEDESEDTDTDGE----EETPQLP 166

  Fly   195 PR-GRPPNHLKKQS---VQLDTAIPAP 217
            |: ..||.|.:...   :...:.:|.|
Mouse   167 PQASHPPAHFQSPPTPFIPFTSPLPLP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2alphaNP_611601.2 CBFD_NFYB_HMF 11..74 CDD:279185 44/62 (71%)
Drap1NP_001278009.1 CBFD_NFYB_HMF 11..74 CDD:279185 44/62 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835202
Domainoid 1 1.000 96 1.000 Domainoid score I7339
eggNOG 1 0.900 - - E1_COG5247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003466
OrthoInspector 1 1.000 - - oto92035
orthoMCL 1 0.900 - - OOG6_103329
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R334
SonicParanoid 1 1.000 - - X2358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.