DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2alpha and Drap1

DIOPT Version :9

Sequence 1:NP_611601.2 Gene:NC2alpha / 37471 FlyBaseID:FBgn0034650 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006230803.1 Gene:Drap1 / 293674 RGDID:1308477 Length:212 Species:Rattus norvegicus


Alignment Length:253 Identity:95/253 - (37%)
Similarity:126/253 - (49%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSKKKKYNARFPAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTL 65
            |||||||||||||..|||||||:||||||||.||||||||.||||:||||.|..::|.:|||||:
  Rat     1 MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTM 65

  Fly    66 SPSHMRQCIVSEKRFDFLKELVRNIPDISVAEEAAYNEDDVLRSSPEEQYPDSDT-PYDLSLPST 129
            :.||::|||..|::|||||:||.::||              ::...|:.:.|.|. |....:||.
  Rat    66 TTSHLKQCIELEQQFDFLKDLVASVPD--------------MQGDGEDNHTDGDKGPRRWPVPSR 116

  Fly   130 SMRSQANGTAAYMRSMSLNNGAGSGGGAAATKRQFQSQHSTQETPTTSTTLPAKLARSGSMPAYT 194
            ..|...        |....||   |.|:.:..::.....|.||..:..|....:    ...|...
  Rat   117 RGRKPG--------SSGRKNG---GTGSKSKDKKLSGTDSEQEDESEDTDTDGE----EETPQAP 166

  Fly   195 PR-GRPPNHLKKQSVQLDTAIPAPICNYELNKPIVKIDYSHVQMPTA--NLCTPDASD 249
            |: ..||.|.:..        |.|...:.          |.:.:|.|  ....|:|.|
  Rat   167 PQASHPPAHFQSP--------PTPFMPFT----------SPLPLPPAPPGPSAPEAED 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2alphaNP_611601.2 CBFD_NFYB_HMF 11..74 CDD:279185 44/62 (71%)
Drap1XP_006230803.1 BUR6 2..92 CDD:227572 63/89 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338803
Domainoid 1 1.000 96 1.000 Domainoid score I7181
eggNOG 1 0.900 - - E1_COG5247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003466
OrthoInspector 1 1.000 - - oto95603
orthoMCL 1 0.900 - - OOG6_103329
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2358
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.750

Return to query results.
Submit another query.