DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2alpha and drap-1

DIOPT Version :9

Sequence 1:NP_611601.2 Gene:NC2alpha / 37471 FlyBaseID:FBgn0034650 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001379124.1 Gene:drap-1 / 179365 WormBaseID:WBGene00009584 Length:331 Species:Caenorhabditis elegans


Alignment Length:221 Identity:60/221 - (27%)
Similarity:99/221 - (44%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKKKYN-ARFPAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSP 67
            :::::: |:....||||:|||||:||::.|:|||.|.|.:|.|.|..|......|...::|||:|
 Worm    57 RRRRFSTAKIQPTRIKKVMQSDEDIGRMVQSVPVSIGRAMEHFAEKFLQAAAEATQFTSSKTLNP 121

  Fly    68 SHMRQCIVSEKRFDFLKELVRNIPDISVAEEAAYNEDDVLRSSPEEQYPDSDTPYDLSLPSTSM- 131
            .||:|.:::...|.||:.:.:   |:::.::|:                      :|:...|.| 
 Worm   122 QHMKQAVLNTPHFSFLESVFK---DVALPQQAS----------------------ELNTARTGMT 161

  Fly   132 -------RSQANGTAAYMRSMSLNNGAGSGGGAAATKRQFQSQHSTQETPTTSTTLPAKLARSGS 189
                   :.|.|...|   |..|.|       |.....|...|...||..|.|..|....:.:..
 Worm   162 LRGQQMLQEQQNSDFA---SAILAN-------AQMQMMQMDQQALKQEDGTISPYLVDPQSPAAP 216

  Fly   190 MPAYTPRGRPPNHLKKQSVQLDTAIP 215
            :|.|. :|.|.|:...|  :|...:|
 Worm   217 LPLYL-QGIPSNYPVVQ--ELTATVP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2alphaNP_611601.2 CBFD_NFYB_HMF 11..74 CDD:279185 29/62 (47%)
drap-1NP_001379124.1 CBFD_NFYB_HMF 64..128 CDD:395650 30/63 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158506
Domainoid 1 1.000 64 1.000 Domainoid score I6731
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003466
OrthoInspector 1 1.000 - - oto17421
orthoMCL 1 0.900 - - OOG6_103329
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R334
SonicParanoid 1 1.000 - - X2358
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.