DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2alpha and DRAP1

DIOPT Version :9

Sequence 1:NP_611601.2 Gene:NC2alpha / 37471 FlyBaseID:FBgn0034650 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_006433.2 Gene:DRAP1 / 10589 HGNCID:3019 Length:205 Species:Homo sapiens


Alignment Length:228 Identity:86/228 - (37%)
Similarity:117/228 - (51%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSKKKKYNARFPAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTL 65
            |||||||||||||..|||||||:||||||||.||||||||.||||:||||.|..::|.:|||||:
Human     1 MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTM 65

  Fly    66 SPSHMRQCIVSEKRFDFLKELVRNIPDISVAEEAAYNEDDVLRSSPEEQYPDSDTPYDLSLPSTS 130
            :.||::|||..|::|||||:||.::||              ::...|:.:.|.|        ..:
Human    66 TTSHLKQCIELEQQFDFLKDLVASVPD--------------MQGDGEDNHMDGD--------KGA 108

  Fly   131 MRSQANGTAAYMRSMSLNNGAGSGG-GAAATKRQFQSQHSTQETPTTSTTLPAKLARSGSMPAYT 194
            .|.:..|          :.|..:|| |..:..::.....|.||..:..|....:...|       
Human   109 RRGRKPG----------SGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETS------- 156

  Fly   195 PRGRPPNHLKKQSVQLDTAIPAPICNYELNKPI 227
               :||......|....:. |.|...:....|:
Human   157 ---QPPPQASHPSAHFQSP-PTPFLPFASTLPL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2alphaNP_611601.2 CBFD_NFYB_HMF 11..74 CDD:279185 44/62 (71%)
DRAP1NP_006433.2 BUR6 2..92 CDD:227572 63/89 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..205 22/138 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145094
Domainoid 1 1.000 96 1.000 Domainoid score I7393
eggNOG 1 0.900 - - E1_COG5247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003466
OrthoInspector 1 1.000 - - oto88464
orthoMCL 1 0.900 - - OOG6_103329
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R334
SonicParanoid 1 1.000 - - X2358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.