DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rae1 and AT1G15850

DIOPT Version :9

Sequence 1:NP_611597.1 Gene:Rae1 / 37467 FlyBaseID:FBgn0034646 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_173037.1 Gene:AT1G15850 / 838155 AraportID:AT1G15850 Length:140 Species:Arabidopsis thaliana


Alignment Length:138 Identity:62/138 - (44%)
Similarity:79/138 - (57%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ATQSTNRMND-FEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV---PKSM 64
            ||.|||..|: :|:..|..||:|:|.|||   :.:.|||.|||..|||||:.::..::   ||..
plant     8 ATSSTNNPNNSYEITPPATDSISSLSFSP---KADILVATSWDCQVRCWEITRSDGSIASEPKVS 69

  Fly    65 KTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASD-QVMQVAAHDGPVKTCHMVKGPTYTCLMT 128
            .:...|||...|.|||:.||...||||.|:|.|.|. |...||.||.|......:  |....|:|
plant    70 MSHDQPVLCSAWKDDGTTVFTGGCDKQAKMWPLLSGAQPSTVAMHDAPFNQIAWI--PGMNLLVT 132

  Fly   129 GSWDKTLK 136
            ||||||||
plant   133 GSWDKTLK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rae1NP_611597.1 WD40 22..310 CDD:421866 54/119 (45%)
WD40 repeat 25..66 CDD:293791 18/43 (42%)
WD40 repeat 71..105 CDD:293791 17/34 (50%)
WD40 repeat 113..150 CDD:293791 11/24 (46%)
WD40 repeat 157..239 CDD:293791
WD40 repeat 255..293 CDD:293791
AT1G15850NP_173037.1 WD40 <26..140 CDD:421866 52/118 (44%)
WD40 repeat 30..71 CDD:293791 18/43 (42%)
WD40 repeat 76..111 CDD:293791 17/34 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1048963at2759
OrthoFinder 1 1.000 - - FOG0003056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.