DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rae1 and Bub3

DIOPT Version :9

Sequence 1:NP_611597.1 Gene:Rae1 / 37467 FlyBaseID:FBgn0034646 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001304279.1 Gene:Bub3 / 12237 MGIID:1343463 Length:326 Species:Mus musculus


Alignment Length:339 Identity:124/339 - (36%)
Similarity:184/339 - (54%) Gaps:25/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDVCW 76
            |:|::..||:|.:|:::|||:|.|  ||:..|||::||.::|..|...: |...|  |.||| |.
Mouse     5 NEFKLNQPPEDGISSVKFSPNTSQ--FLLVSSWDTSVRLYDVPANSMRL-KYQHT--GAVLD-CA 63

  Fly    77 SDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFWDTR 141
            ..|.:..:....|.|:|:.||.:||...|..||.|::.....  |....::|||||:|:|.||.|
Mouse    64 FYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYC--PEVNVMVTGSWDQTVKLWDPR 126

  Fly   142 SPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHRAISIFRDK 206
            :|....|.:.||:.|...|.....:||||.|.::::.|:|.....:|:||.||||.|.|..|.:|
Mouse   127 TPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNK 191

  Fly   207 KKEPTGCALGSIEGRVAIQYVNPGNP---KDNFTFKCHRTTGTSGYQDIYAVNDIAFHPVHGTLV 268
            :    |..|.|||||||::|::| :|   |..:.|||||.. .:..:.||.||.|:||.:|.|..
Mouse   192 Q----GYVLSSIEGRVAVEYLDP-SPEVQKKKYAFKCHRLK-ENNIEQIYPVNAISFHNIHNTFA 250

  Fly   269 TVGSDGTFSFWDKDARTKLKSSETMDQSITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQ-- 331
            |.||||..:.||...:.:|........||....|:.:|...|.|..|.:.     .:..:.|:  
Mouse   251 TGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE-----MDDTEHPEDG 310

  Fly   332 IFLRSCYD-ELKPR 344
            ||:|...| |.||:
Mouse   311 IFIRQVTDAETKPK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rae1NP_611597.1 WD40 22..310 CDD:421866 109/290 (38%)
WD40 repeat 25..66 CDD:293791 16/40 (40%)
WD40 repeat 71..105 CDD:293791 12/33 (36%)
WD40 repeat 113..150 CDD:293791 13/36 (36%)
WD40 repeat 157..239 CDD:293791 32/84 (38%)
WD40 repeat 255..293 CDD:293791 15/37 (41%)
Bub3NP_001304279.1 WD 1 5..43 18/39 (46%)
WD40 14..296 CDD:421866 111/295 (38%)
WD40 repeat 17..54 CDD:293791 16/39 (41%)
WD 2 46..83 12/40 (30%)
WD40 repeat 60..94 CDD:293791 12/34 (35%)
WD 3 86..124 14/39 (36%)
WD40 repeat 99..134 CDD:293791 12/36 (33%)
WD 4 128..163 11/34 (32%)
WD40 repeat 141..175 CDD:293791 10/33 (30%)
WD40 repeat 182..222 CDD:293791 17/44 (39%)
WD 5 223..262 17/39 (44%)
WD40 repeat 237..274 CDD:293791 15/36 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53489
OrthoDB 1 1.010 - - D1048963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.