DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rae1 and LOC103910025

DIOPT Version :9

Sequence 1:	NP_611597.1	Gene:	Rae1 / 37467	FlyBaseID:	FBgn0034646	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	XP_009296683.1	Gene:	LOC103910025 / 103910025	-ID:	-	Length:	94	Species:	Danio rerio

Alignment Length:	124	Identity:	36/124 - (29%)
Similarity:	55/124 - (44%)	Gaps:	39/124 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 ATQSTNRM---NDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMK 65
            |.:::..|   |:|::|..|:|||||::||||:.|  ||:..|||.:||.::...|.    ..||
Zfish     6 AAENSGTMTGANEFKLAQGPEDSVSAVKFSPSSSQ--FLLVSSWDGSVRLYDASANS----MRMK 64

  Fly    66 TMG-GPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKGPTY 123
            ... .||||..:|                            ..|| |:..|.:..|.::
Zfish    65 YQHLAPVLDCAFS----------------------------VGHD-PITHCRIHTGDSH 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rae1	NP_611597.1	WD40	22..310	CDD:421866	30/103 (29%)
		WD40 repeat	25..66	CDD:293791	16/40 (40%)
		WD40 repeat	71..105	CDD:293791	4/33 (12%)
		WD40 repeat	113..150	CDD:293791	2/11 (18%)
		WD40 repeat	157..239	CDD:293791
		WD40 repeat	255..293	CDD:293791
LOC103910025	XP_009296683.1	WD40	<23..>77	CDD:295369	25/59 (42%)
		WD40	<23..>77	CDD:225201	25/59 (42%)
		WD40 repeat	29..66	CDD:293791	18/42 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1048963at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010