DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B12 and AT2G02510

DIOPT Version :9

Sequence 1:NP_001097399.1 Gene:ND-B12 / 37466 FlyBaseID:FBgn0034645 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_178355.1 Gene:AT2G02510 / 814780 AraportID:AT2G02510 Length:72 Species:Arabidopsis thaliana


Alignment Length:65 Identity:19/65 - (29%)
Similarity:25/65 - (38%) Gaps:6/65 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LGRQGLKDPWLRNEVWRYEPKAFGTHRSRLNTFLFRGLGVG-FCAFLATVAVEYALGIGKGQGGH 95
            ||..|  :.:.|.:.||..|......|..|...   |:||| ||.:|....:...|.....|..|
plant     5 LGTTG--EFFRRRDEWRKHPMLSNQMRHALPGI---GIGVGAFCVYLVGEQIYSKLMAPSSQSSH 64

  Fly    96  95
            plant    65  64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B12NP_001097399.1 NDUF_B12 38..86 CDD:400443 13/48 (27%)
AT2G02510NP_178355.1 NDUF_B12 14..54 CDD:285354 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1568057at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15082
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.