powered by:
Protein Alignment ND-B12 and AT2G02510
DIOPT Version :9
Sequence 1: | NP_001097399.1 |
Gene: | ND-B12 / 37466 |
FlyBaseID: | FBgn0034645 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_178355.1 |
Gene: | AT2G02510 / 814780 |
AraportID: | AT2G02510 |
Length: | 72 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 25/65 - (38%) |
Gaps: | 6/65 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 LGRQGLKDPWLRNEVWRYEPKAFGTHRSRLNTFLFRGLGVG-FCAFLATVAVEYALGIGKGQGGH 95
||..| :.:.|.:.||..|......|..|... |:||| ||.:|....:...|.....|..|
plant 5 LGTTG--EFFRRRDEWRKHPMLSNQMRHALPGI---GIGVGAFCVYLVGEQIYSKLMAPSSQSSH 64
Fly 96 95
plant 65 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1568057at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15082 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.110 |
|
Return to query results.
Submit another query.