DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B12 and Ndufb3

DIOPT Version :9

Sequence 1:NP_001097399.1 Gene:ND-B12 / 37466 FlyBaseID:FBgn0034645 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_079873.1 Gene:Ndufb3 / 66495 MGIID:1913745 Length:104 Species:Mus musculus


Alignment Length:112 Identity:38/112 - (33%)
Similarity:53/112 - (47%) Gaps:25/112 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GH-HGEPYTVPHASTYKVESVPQLVEVKEALGRQGLKDPWLRNEVWRYEPKAFGTHRSRLNTF-- 64
            || ||: ..:|....:|:|..| |..|::.|..:||:|||.|||.|||    .|.....: ||  
Mouse    14 GHGHGK-MELPDYRQWKIEGTP-LETVQKKLAARGLRDPWARNEAWRY----MGGFAGNI-TFPS 71

  Fly    65 -LFRGLGVGFCAFLATVAVEYALGIGKGQGGHGHGHGHEEHGDKGHH 110
             :.:|...||.||:..:..||.|              ..::|||.||
Mouse    72 VILKGFKWGFAAFVVALGAEYFL--------------DSQNGDKKHH 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B12NP_001097399.1 NDUF_B12 38..86 CDD:400443 19/50 (38%)
Ndufb3NP_079873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 4/6 (67%)
NDUF_B12 48..103 CDD:400443 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5440
Isobase 1 0.950 - 0 Normalized mean entropy S6959
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006542
OrthoInspector 1 1.000 - - oto94107
orthoMCL 1 0.900 - - OOG6_109209
Panther 1 1.100 - - LDO PTHR15082
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5815
SonicParanoid 1 1.000 - - X4780
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.