DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B12 and C18E9.4

DIOPT Version :9

Sequence 1:NP_001097399.1 Gene:ND-B12 / 37466 FlyBaseID:FBgn0034645 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_495907.1 Gene:C18E9.4 / 174428 WormBaseID:WBGene00007684 Length:103 Species:Caenorhabditis elegans


Alignment Length:121 Identity:41/121 - (33%)
Similarity:57/121 - (47%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGHHGEPYTVPHASTY-KVESVPQLVEVKEALGRQGLKDPWLRNEVWRYE---PKAFG--THRS 59
            |||.|.||:.:|:.|.| .....|||.:.::.|.:.||||||:||.|:.|:   |...|  .|..
 Worm     1 MGGGHHEPFKIPNYSIYSNFRDFPQLAQHEKRLAQIGLKDPWIRNYVYLYDRKYPHVVGQWAHFK 65

  Fly    60 RLNTFLFRG--LGVGFCAFLATVAVEYALGIGKGQGGHGHGHGHEEHGD---KGHH 110
            :|   :..|  .||.|.|  |.:.||.|             :.::.||.   .|||
 Worm    66 KL---ILPGWKAGVAFTA--ALIFVEEA-------------YQYKTHGTTSWDGHH 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B12NP_001097399.1 NDUF_B12 38..86 CDD:400443 20/54 (37%)
C18E9.4NP_495907.1 NDUF_B12 39..95 CDD:285354 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1568057at2759
OrthoFinder 1 1.000 - - FOG0006542
OrthoInspector 1 1.000 - - oto17865
orthoMCL 1 0.900 - - OOG6_109209
Panther 1 1.100 - - LDO PTHR15082
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5815
SonicParanoid 1 1.000 - - X4780
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.