DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B12 and ndufb3

DIOPT Version :9

Sequence 1:NP_001097399.1 Gene:ND-B12 / 37466 FlyBaseID:FBgn0034645 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001289399.1 Gene:ndufb3 / 100332034 ZFINID:ZDB-GENE-091204-407 Length:94 Species:Danio rerio


Alignment Length:87 Identity:37/87 - (42%)
Similarity:49/87 - (56%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGHHGEPY---TVPHASTYKVESVPQLVEVKEALGRQGLKDPWLRNEVWRYEPKAFGTHRSRLN 62
            |||.||..:   .:|....:|.|..| |..|::.|..:||:|||.|||.|||: ..|....|..:
Zfish     1 MGGDHGHAHGKTPLPDYRQWKWEGTP-LEVVQKKLAGKGLRDPWARNEAWRYK-GTFSIPISLKD 63

  Fly    63 TFLFRGLGVGFCAFLATVAVEY 84
            .|| ||...||.||:.::||||
Zfish    64 VFL-RGFKYGFAAFVVSLAVEY 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B12NP_001097399.1 NDUF_B12 38..86 CDD:400443 23/47 (49%)
ndufb3NP_001289399.1 NDUF_B12 40..94 CDD:285354 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593967
Domainoid 1 1.000 44 1.000 Domainoid score I12351
eggNOG 1 0.900 - - E1_KOG4631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5402
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1568057at2759
OrthoFinder 1 1.000 - - FOG0006542
OrthoInspector 1 1.000 - - oto39866
orthoMCL 1 0.900 - - OOG6_109209
Panther 1 1.100 - - LDO PTHR15082
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5815
SonicParanoid 1 1.000 - - X4780
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.