DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10082 and Ipk2

DIOPT Version :9

Sequence 1:NP_726095.2 Gene:CG10082 / 37465 FlyBaseID:FBgn0034644 Length:902 Species:Drosophila melanogaster
Sequence 2:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster


Alignment Length:313 Identity:77/313 - (24%)
Similarity:121/313 - (38%) Gaps:106/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 DNEDEVALHPLSNQVGGHT-------RLLLLNQS---TVIKPLNL-----RELDFYQNIPQ---- 221
            |.|.......|..||.|||       .:.||..|   .|:|||..     |||.||:::.:    
  Fly     5 DQELPEGFRQLKTQVAGHTFEESNAEAVGLLQDSKAGCVLKPLGKPECGERELRFYESLAEAGAS 69

  Fly   222 ---DILKF----VPKYKGVMQATTMGGAKLDKRYSPSFRDDAAAVPVRKMSASKRKRDEVLRMKV 279
               |:|..    ||::.|.:                            |:..::|:|.       
  Fly    70 GDNDLLALLRGHVPRFYGPL----------------------------KLVVNRRERT------- 99

  Fly   280 HKNGQAAEVIKSISQLDNTNKQYFLMLENITSQFRNPCILDLKMGTRQHGDDASAEKRSKQMAKC 344
                                   ||.||::|..:..||::|:|||.|....::|..||..:.||.
  Fly   100 -----------------------FLRLEDLTRSYAKPCVMDVKMGKRTWDPESSPNKRKVEEAKY 141

  Fly   345 AASTSGSLGVRLCGMQTYLADLEQ-----YAKRDKYWGRELNEGGFKTALHDFFH---------- 394
            ..... .||:.|.|.|.||...|.     ..:..|.:|:.||..|||..:..||:          
  Fly   142 VMCKQ-KLGLCLPGFQVYLPKEEHTQETTILRHGKDYGKSLNVEGFKQTMALFFNASTSDSKSRR 205

  Fly   395 NGYRLRIRVIRKILQRLLQLRRVIEKQSSYRFYSCSLLIVYEGFEENPMAPPP 447
            .|..|   :::::|::|.::....::|....||:.||||.|   :.:.:|.||
  Fly   206 AGCEL---LLKEVLRQLQEILAWFQRQRLLHFYASSLLICY---DYSRLADPP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10082NP_726095.2 IPK 303..>450 CDD:281727 49/160 (31%)
IPK <821..894 CDD:299948
Ipk2NP_608535.1 IPK 100..304 CDD:281727 49/160 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455384
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1620
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452635at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12400
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3597
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.