DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and ZNF131

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001284477.1 Gene:ZNF131 / 7690 HGNCID:12915 Length:623 Species:Homo sapiens


Alignment Length:473 Identity:81/473 - (17%)
Similarity:161/473 - (34%) Gaps:133/473 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 LDDDQQQDFLKDHHEHHQVMINEDLTQSESQD----------------------------HEYFD 402
            ::.::..:.|::..|||: ||.:.|.:...||                            :::|.
Human     1 MEAEETMECLQEFPEHHK-MILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFYKFFQ 64

  Fly   403 DLDQQQAMDEIEDEEEQMKPEEDQDTFIIEEIQLEDDEMLDDPDGEEIDQDCEYIGEEQDPHLSG 467
            :..|:..: |||...:.......:.|:..:.:...::|..|.....|..|..|.|          
Human    65 EFTQEPLV-EIEGVSKMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAI---------- 118

  Fly   468 DVDDDLEYSIMEPPDGETSVDIDQAFMDSEQSHHQQHQE------------EMQSISLENAVVEF 520
                    ..:|..:.|.|..:::......::..::..|            |.:.:.:|   ||.
Human   119 --------KALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLPSAESEPVEIE---VEI 172

  Fly   521 SQATTTTEALVGPTM-TVSSASPTPKRAKRSNHQIPAGVTLEPCDHQPPAAGSTTSSKLA----- 579
            ::.|...|.....|: .|:||..:.|..:                    :.||:..|.||     
Human   173 AEGTIEVEDEGIETLEEVASAKQSVKYIQ--------------------STGSSDDSALALLADI 217

  Fly   580 AANSRQLVQTASVIAAAGADD--NYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQN 642
            .:..||..:...:.......|  :.:::...:.|....|...|    :.|..|:..|:.|...:.
Human   218 TSKYRQGDRKGQIKEDGCPSDPTSKQVEGIEIVELQLSHVKDL----FHCEKCNRSFKLFYHFKE 278

  Fly   643 HMHSHTNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAE-----------SSTPMCTICNRT 696
            ||.||:.       :..:|:||.|.:......:.|:..:..|           ....:|..|.:.
Human   279 HMKSHST-------ESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQ 336

  Fly   697 FKSKAILYRHRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVE-----------RKHPEVVDPLFK 749
            |........|.:.|. ::.:.|  .||.:.|:....||.|:.           ||      .|::
Human   337 FDHFGHFKEHLRKHTGEKPFEC--PNCHERFARNSTLKCHLTACQTGVGAKKGRK------KLYE 393

  Fly   750 CGECGSLYDNVDSLQLHV 767
            |..|.|::::.|..:.|:
Human   394 CQVCNSVFNSWDQFKDHL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 17/122 (14%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 5/19 (26%)
C2H2 Zn finger 690..710 CDD:275368 4/19 (21%)
C2H2 Zn finger 717..740 CDD:275368 8/33 (24%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
ZNF131NP_001284477.1 BTB 24..122 CDD:279045 15/116 (13%)
BTB 35..122 CDD:197585 12/105 (11%)
Nuclear localization signal 1. /evidence=ECO:0000269|PubMed:17306895 137..148 0/10 (0%)
COG5048 <262..444 CDD:227381 34/165 (21%)
C2H2 Zn finger 263..283 CDD:275368 6/19 (32%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
Nuclear localization signal 2. /evidence=ECO:0000269|PubMed:17306895 317..328 0/10 (0%)
C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
zf-H2C2_2 342..367 CDD:290200 6/26 (23%)
C2H2 Zn finger 358..375 CDD:275368 6/18 (33%)
C2H2 Zn finger 394..414 CDD:275368 5/18 (28%)
C2H2 Zn finger 422..439 CDD:275370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 573..623
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.