Sequence 1: | NP_001261124.1 | Gene: | CG10321 / 37464 | FlyBaseID: | FBgn0034643 | Length: | 855 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083438.1 | Gene: | Zbtb49 / 75079 | MGIID: | 1922329 | Length: | 756 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 57/206 - (27%) |
---|---|---|---|
Similarity: | 81/206 - (39%) | Gaps: | 40/206 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 624 RYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTP 688
Fly 689 MCTICNRTFKSKAILYRHRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGE 752
Fly 753 CGSLYDNVDSLQLHVESTDHSAEVQISGQDDAFSGAVSIVSNGTTDMSNMMATGQGTTLAGGTGD 817
Fly 818 THAVVMGSSGE 828 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10321 | NP_001261124.1 | zf-AD | 12..80 | CDD:214871 | |
ASF1_hist_chap | <405..516 | CDD:304562 | |||
C2H2 Zn finger | 627..647 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 661..681 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 690..710 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 717..740 | CDD:275368 | 8/22 (36%) | ||
C2H2 Zn finger | 750..767 | CDD:275368 | 5/16 (31%) | ||
Zbtb49 | NP_083438.1 | BTB | 15..118 | CDD:279045 | |
BTB | 26..119 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..197 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 226..290 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 311..379 | ||||
COG5048 | <376..576 | CDD:227381 | 57/206 (28%) | ||
zf-C2H2 | 386..408 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 388..408 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 400..425 | CDD:290200 | 11/30 (37%) | ||
C2H2 Zn finger | 416..436 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 428..452 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 444..464 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 456..481 | CDD:290200 | 6/26 (23%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | 9/24 (38%) | ||
zf-H2C2_2 | 484..508 | CDD:290200 | 11/26 (42%) | ||
C2H2 Zn finger | 500..520 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 513..535 | CDD:290200 | 7/48 (15%) | ||
C2H2 Zn finger | 528..548 | CDD:275368 | 7/22 (32%) | ||
zf-H2C2_2 | 540..565 | CDD:290200 | 4/12 (33%) | ||
C2H2 Zn finger | 556..576 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24399 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |