DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and Zbtb34

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_038962138.1 Gene:Zbtb34 / 689174 RGDID:1596130 Length:518 Species:Rattus norvegicus


Alignment Length:512 Identity:95/512 - (18%)
Similarity:173/512 - (33%) Gaps:121/512 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 AAQSQFL--PQLLQTPNGQTLQIVQQPN-----------GTQTLQLVQLVPQRSLAPTGVTTVTT 312
            ||.|.:.  ...|.|.:|.::.:::.|:           |..:|||..:|...: |.:.:.....
  Rat    69 AASSPYFRDHSALSTMSGLSISVIKNPSVFEQLLSFCYTGRMSLQLKDVVSFLT-AASFLQMQCV 132

  Fly   313 TTNATDMGQHVGASLGDADVQLLEDGCEVEDEELEDVYEQLDSKADHSFETIVLDDDQQQDFLKD 377
            ....|.:.:.:.:.:...||..:..|.|...|....|       .|.||.|..::       :..
  Rat   133 IDKCTQILESIHSKISVGDVDSVTIGAEETPESRNGV-------KDGSFFTSPVE-------ISP 183

  Fly   378 HH--EHHQVMINEDLTQSESQDHEYFDDLDQQQAMD-----EIEDEEEQMKPEEDQDTFIIEEIQ 435
            .:  :..|..::.||....:.:......|.::...|     .:.:.|.|::.:.:|...::.|.|
  Rat   184 PYCPQVRQPPVSSDLRMETTPNKALRSRLQEEGHSDRGSSGSVSEYEVQIEGDHEQGDLLVRESQ 248

  Fly   436 LED----DEMLDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFMDS 496
            :.:    .|..|.|...:                |..:.||..::  |..|||..|.::.....|
  Rat   249 ITEVKVKMEKSDRPSCSD----------------SSSLGDDGYHT--EMVDGEQVVAVNVGTYGS 295

  Fly   497 EQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPK-----RAKRSNHQIPA 556
            ...|...:.:..            ||.::..||..|.|    ::||:..     |.:.:..:...
  Rat   296 VLQHAYPYSQAA------------SQPSSVPEAFGGQT----NSSPSRSMLSCFRGRGARQKRAL 344

  Fly   557 GVTLEPCDHQPPAAGSTTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSPLG 621
            .|.|. .|.|....||.:.:.:                     :|...:::......|.:..|..
  Rat   345 SVHLH-SDLQGVVQGSDSEAMM---------------------NNPGYESSPRERSARGYWYPYN 387

  Fly   622 SGRYICHLCSTEFRQFKGLQNHMHSH---TNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDA 683
            . |.||..|...|.|...|..||..|   |.::         |:.|.|.:.....|..|::.| .
  Rat   388 E-RLICIYCGKSFNQKGSLDRHMRLHMGITPFV---------CKFCGKKYTRKDQLEYHIRGH-T 441

  Fly   684 ESSTPMCTICNRTFKSKAILYRH-RQTHQQRAYCCGVANCRKNFSSAVNLKWHVERK 739
            :.....|.:|.:.|..:..|.:| |:.|.      ||...|....|......:.|:|
  Rat   442 DDKPFRCEVCGKCFPFQGTLNQHLRKNHP------GVTEGRGRMESPERTDVYGEQK 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 19/119 (16%)
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 5/19 (26%)
C2H2 Zn finger 690..710 CDD:275368 6/20 (30%)
C2H2 Zn finger 717..740 CDD:275368 6/23 (26%)
C2H2 Zn finger 750..767 CDD:275368
Zbtb34XP_038962138.1 BTB_POZ_ZBTB34 25..144 CDD:349529 14/75 (19%)
ZnF_C2H2 390..412 CDD:197676 8/21 (38%)
C2H2 Zn finger 392..412 CDD:275368 7/19 (37%)
zf-H2C2_2 404..429 CDD:404364 8/33 (24%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
zf-H2C2_2 433..455 CDD:404364 5/22 (23%)
zf-C2H2 446..467 CDD:395048 5/20 (25%)
C2H2 Zn finger 448..466 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.