DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and Zfp422

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001289368.1 Gene:Zfp422 / 67255 MGIID:1914505 Length:237 Species:Mus musculus


Alignment Length:145 Identity:43/145 - (29%)
Similarity:62/145 - (42%) Gaps:13/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 YICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPM 689
            |.|..||..|.|...|..|...||.      ||..:|..|.|||.....|..|.:.|..|... .
Mouse    55 YKCAKCSKSFSQSSTLFQHKKIHTG------KKSHKCADCGKSFFQSSNLIQHRRIHTGEKPY-K 112

  Fly   690 CTICNRTFKSKAILYRHRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGEC 753
            |..|...||..:.|.:|::.|. ::.|||.  .|.:.||.:.:|..| :|.|  ..:..::|.||
Mouse   113 CDECGERFKQSSNLIQHQRIHTGEKPYCCD--ECGRCFSQSSHLIQH-QRTH--TGEKPYQCEEC 172

  Fly   754 GSLYDNVDSLQLHVE 768
            ...:.....|:.|::
Mouse   173 DKCFSQSSHLRQHMK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 7/19 (37%)
C2H2 Zn finger 690..710 CDD:275368 6/19 (32%)
C2H2 Zn finger 717..740 CDD:275368 7/22 (32%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
Zfp422NP_001289368.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
COG5048 <53..195 CDD:227381 43/145 (30%)
C2H2 Zn finger 57..77 CDD:275368 7/19 (37%)
C2H2 Zn finger 85..105 CDD:275368 7/19 (37%)
C2H2 Zn finger 113..133 CDD:275368 6/19 (32%)
C2H2 Zn finger 141..161 CDD:275368 7/22 (32%)
C2H2 Zn finger 169..189 CDD:275368 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..219 43/145 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.