DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and ZBTB26

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001291292.1 Gene:ZBTB26 / 57684 HGNCID:23383 Length:441 Species:Homo sapiens


Alignment Length:282 Identity:62/282 - (21%)
Similarity:105/282 - (37%) Gaps:55/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 EPPDGETSVDIDQAFMDSEQSHHQQ--------------HQEEMQSISLENAVVEFSQATTTTEA 529
            :|.|.:...:...|   |.||..||              |..| .|:.:|::.::..:..:    
Human   131 QPMDSKEGCEPQSA---SPQSKEQQGDARGSPKQDSPCIHPSE-DSMDMEDSDIQIVKVES---- 187

  Fly   530 LVGPTMTVSSASPTPKRAKRSNHQIPAGVTLEP-----CDHQPPAAGSTTSSKLAAANSRQLVQT 589
             :|....|        |:|:..:|.   ::.||     .:.|.....||..::::......|...
Human   188 -IGDVSEV--------RSKKDQNQF---ISSEPTALHSSEPQHSLINSTVENRVSEIEQNHLHNY 240

  Fly   590 ASVIAAAGADDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRAN 654
            |  ::..|:|:......::....||.....| ...:.|..|:..||..:...||:..|       
Human   241 A--LSYTGSDNIIMASKDVFGPNIRGVDKGL-QWHHQCPKCTRVFRHLENYANHLKMH------- 295

  Fly   655 CKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QRAYCCG 718
              |...|.:|.|:|...|.|..||:.| |......|.||.:||..|..|..|...|. .:.:.|.
Human   296 --KLFMCLLCGKTFTQKGNLHRHMRVH-AGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCN 357

  Fly   719 VANCRKNFSSAVNLKWHVERKH 740
            .  |...|:....|:.|:::.|
Human   358 Y--CDMVFAHKPVLRKHLKQLH 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 12/50 (24%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 8/19 (42%)
C2H2 Zn finger 690..710 CDD:275368 8/19 (42%)
C2H2 Zn finger 717..740 CDD:275368 5/22 (23%)
C2H2 Zn finger 750..767 CDD:275368
ZBTB26NP_001291292.1 BTB_POZ_ZBTB26_Bioref 8..129 CDD:349523
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..177 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..216 6/32 (19%)
COG5236 <269..>381 CDD:227561 34/122 (28%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-C2H2 298..320 CDD:395048 8/21 (38%)
C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
zf-H2C2_2 315..337 CDD:404364 9/22 (41%)
C2H2 Zn finger 328..348 CDD:275368 8/19 (42%)
C2H2 Zn finger 356..374 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.