DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and zbtb25

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_017208223.1 Gene:zbtb25 / 567401 ZFINID:ZDB-GENE-041001-125 Length:458 Species:Danio rerio


Alignment Length:242 Identity:45/242 - (18%)
Similarity:76/242 - (31%) Gaps:88/242 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   547 AKRSNHQIPAGVTLEPCDHQPPAAGSTTSSKLAAA------NSRQLVQTASVIAAAGADDNYEID 605
            |.:.|..:.||.:.:|.|.:.......|..:||.|      .|.|..|:....::..:.|:.:|.
Zfish   163 ANKENSGLKAGGSRDPEDGRSSTRADRTHGRLALAVGLEGIASEQHPQSFHAASSVASGDDSDIS 227

  Fly   606 ANLVTEFIRQ----------------HTSPLGSGRY-------ICHLCSTEFRQFKGLQNHMHSH 647
            |.:..|.:.:                ..||..:|.:       :|..|.......:|||.|:.:|
Zfish   228 ARIKQERVEEEEQQEGDKESSALSPAQVSPCQAGLFRDGPLALLCPRCGERCLSPEGLQEHLFTH 292

  Fly   648 TNWIRANC-----------------------KKQPQCQICLKSFKGPGMLRMHMKTHDA------ 683
                 |.|                       :::|     ||.....|.|...::...|      
Zfish   293 -----AACALESSTLMEGPSEDKSGEHASLEERRP-----LKEPIDSGSLEEALRQSQALADELA 347

  Fly   684 ----------ESSTPM----------CTICNRTFKSKAILYRHRQTH 710
                      .|::|:          |.:||..|..|:.|..|...|
Zfish   348 VELRRGGGTGRSASPLAAFTRKRKMACAVCNLRFSQKSQLQEHMFAH 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 4/19 (21%)
C2H2 Zn finger 690..710 CDD:275368 7/19 (37%)
C2H2 Zn finger 717..740 CDD:275368
C2H2 Zn finger 750..767 CDD:275368
zbtb25XP_017208223.1 BTB 39..126 CDD:306997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.