DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and Zfp3

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001102504.1 Gene:Zfp3 / 497944 RGDID:1565881 Length:503 Species:Rattus norvegicus


Alignment Length:388 Identity:84/388 - (21%)
Similarity:140/388 - (36%) Gaps:77/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 EDDEMLDDPDGEEIDQDCEYIG--------EEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAF 493
            |:.|:|..   |:|.||||..|        |....|..|...::   .|:|....|:|.:|.:..
  Rat     4 EEKEVLPK---EDISQDCESHGPTLEKLAQEVYQGHEFGAASEE---DILEGHLRESSQEIIEQM 62

  Fly   494 MDSEQ---------------SHHQQHQEEMQSISLENAVV----EFSQATTTTEALVG----PTM 535
            ...|:               ...|:|:|..:..|...:|:    :.:....:|.|..|    .::
  Rat    63 YPQERDFASGLIIFKRSSSGEKDQKHRESPRGFSPNTSVLMCHGDATAERVSTCAASGQNFMESI 127

  Fly   536 TVSSASPTP------------KRAKRSNH-----QIPAGVTLEPCDHQPPAAGSTTSSKLAAANS 583
            .::.|..||            |...:::|     ::.:|.....|..    .|.|..:..:....
  Rat   128 ELTKAQRTPVGEKPHTCKECGKTFNQNSHLIQHMRVHSGEKPFECKE----CGKTFGTNSSLRRH 188

  Fly   584 RQLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHT 648
            :::.......|.......:...::|    |..|....|...|.|..|...|.|...|..|...||
  Rat   189 QRIHAGEKPFACTECGKAFIQSSHL----IHHHRIHTGERPYKCEECGKAFSQNSALILHQRIHT 249

  Fly   649 NWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-Q 712
            .      :|..:|..|.|:|:....|..|.:.| .|.....|:.|.:.||..:.|.||::.|. :
  Rat   250 G------EKPYECNECRKTFRVSSQLIQHQRIH-TEERYHECSECGKAFKHSSGLIRHQKIHTGE 307

  Fly   713 RAYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLHVESTDHSAE 775
            :.|.|.  .|.|.|..:..|..| :|.|  ..|..::|.|||..:.....:..|:..  |:.|
  Rat   308 KPYLCN--ECGKGFGQSSELIRH-QRIH--TGDKPYECSECGKTFGQNSEIIRHIRI--HTGE 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 23/101 (23%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 6/19 (32%)
C2H2 Zn finger 690..710 CDD:275368 7/19 (37%)
C2H2 Zn finger 717..740 CDD:275368 7/22 (32%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
Zfp3NP_001102504.1 C2H2 Zn finger 116..136 CDD:275368 3/19 (16%)
COG5048 122..496 CDD:227381 57/264 (22%)
zf-C2H2 142..164 CDD:278523 2/21 (10%)
C2H2 Zn finger 144..164 CDD:275368 2/19 (11%)
zf-H2C2_2 156..181 CDD:290200 5/28 (18%)
C2H2 Zn finger 172..192 CDD:275368 3/23 (13%)
zf-H2C2_2 184..209 CDD:290200 1/24 (4%)
C2H2 Zn finger 200..220 CDD:275368 3/23 (13%)
zf-H2C2_2 212..237 CDD:290200 8/28 (29%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 297..319 CDD:290200 8/23 (35%)
C2H2 Zn finger 312..332 CDD:275368 7/22 (32%)
zf-H2C2_2 324..347 CDD:290200 9/25 (36%)
C2H2 Zn finger 340..360 CDD:275368 5/21 (24%)
zf-H2C2_2 355..375 CDD:290200 3/11 (27%)
C2H2 Zn finger 368..388 CDD:275368
zf-H2C2_2 380..405 CDD:290200
C2H2 Zn finger 396..416 CDD:275368
C2H2 Zn finger 424..444 CDD:275368
zf-H2C2_2 436..461 CDD:290200
C2H2 Zn finger 452..472 CDD:275368
zf-H2C2_2 465..489 CDD:290200
C2H2 Zn finger 480..500 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.