DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and CG1792

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:219 Identity:51/219 - (23%)
Similarity:78/219 - (35%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 TEFRQFKGLQNHMHSHTNWI-----------RANCKKQPQCQICLKSFKGPGMLRMHMKTHDAES 685
            |.|...|...|...:.|.|.           |...|:...|:.|.:.|..|...::|:..|....
  Fly   158 TVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVK 222

  Fly   686 STPMCTICNRTFKSKAILYRHRQTHQQRA-YCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFK 749
            |. .|..|::.|.:..:|.||::.|...| :.|  ..|...:|:|.....|...:|..|..  |.
  Fly   223 SF-ACDQCSQQFYTATLLRRHQELHAGNALFQC--RYCEATYSNASGRIQHERMRHTNVKP--FT 282

  Fly   750 CGECGSLYDNVDSLQLHVES-----TDHSAEVQIS--------------GQDDAFSGAVSIVSNG 795
            |.||...:.....|:.|:.|     ..|....|:|              |.....|...::.:..
  Fly   283 CKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPV 347

  Fly   796 TTDM--SNMMATG-QGTTLAGGTG 816
            ..|:  ||.|.|| :...|.|.:|
  Fly   348 ELDVKASNGMQTGAKDEALLGKSG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 4/14 (29%)
C2H2 Zn finger 661..681 CDD:275368 5/19 (26%)
C2H2 Zn finger 690..710 CDD:275368 6/19 (32%)
C2H2 Zn finger 717..740 CDD:275368 5/22 (23%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 5/22 (23%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 5/19 (26%)
zf-H2C2_2 296..320 CDD:290200 6/23 (26%)
C2H2 Zn finger 311..329 CDD:275368 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.