DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and CG17802

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster


Alignment Length:432 Identity:98/432 - (22%)
Similarity:160/432 - (37%) Gaps:120/432 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 HVGASLGDADV--QLLEDGCEVEDEELE---DVY----EQLDSKADHSFETIVLDDDQQQDFLKD 377
            |.|..:.||:|  ::|.:....::|.||   |:|    |:.:...:..||.|..    :..|.|:
  Fly    97 HEGLKINDAEVEQEVLYEVSYADNEGLEEDHDLYKKEEEESEVNENKEFEDIAC----EIPFSKE 157

  Fly   378 HHEHHQVMINEDLTQSESQDHEYFDDLDQQQAMDEIE-DEEEQMKPEEDQDTFIIEEIQLEDDEM 441
            ..|..|....||:...:: .|   ||.::.|..:|.: ||||..:.|||:     ||.|.:|||:
  Fly   158 DDEQEQQQEYEDMVDKKT-GH---DDGEESQECEESQPDEEESQQNEEDE-----EESQEDDDEL 213

  Fly   442 LDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFMDSEQSHHQQHQE 506
            ..:.||:                  .|.|.| ..|.:|....::::|.|:          :..::
  Fly   214 WQNEDGD------------------SDTDAD-SMSDIEATSRQSALDEDK----------KPRRK 249

  Fly   507 EMQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPKRAKRSNHQIPAGVTLEPCDHQPPAAG 571
            ..:..|.:|...:|.:                     |.:.||..: |...|.:  |||    .|
  Fly   250 YTKRSSPKNDDTDFLK---------------------PAKKKRKTY-ISQKVHI--CDH----CG 286

  Fly   572 STTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQ 636
            ...:.|   .|....|...|.:......:..:.:.|.....|.......|...|.|..|...|  
  Fly   287 KKFTDK---GNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERF-- 346

  Fly   637 FKGLQNHMHS-HTNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSK 700
               :.:.|.| |.|.:..| ||.|      |:||                    |..|::.::|.
  Fly   347 ---VHSTMRSRHENRVHRN-KKTP------KNFK--------------------CNYCDKRYESN 381

  Fly   701 AILYRHRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHV-ERKH 740
            ....:|...|. :|.:.|.|  |:.:|:...|||.|. .|:|
  Fly   382 YQRAKHEVVHTGERNFHCEV--CKVSFTRNSNLKTHYRSRQH 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 25/111 (23%)
C2H2 Zn finger 627..647 CDD:275368 5/20 (25%)
C2H2 Zn finger 661..681 CDD:275368 3/19 (16%)
C2H2 Zn finger 690..710 CDD:275368 4/19 (21%)
C2H2 Zn finger 717..740 CDD:275368 9/23 (39%)
C2H2 Zn finger 750..767 CDD:275368
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 7/26 (27%)
C2H2 Zn finger 310..331 CDD:275368 2/20 (10%)
C2H2 Zn finger 339..360 CDD:275368 7/25 (28%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 9/24 (38%)
C2H2 Zn finger 399..417 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.