| Sequence 1: | NP_001261124.1 | Gene: | CG10321 / 37464 | FlyBaseID: | FBgn0034643 | Length: | 855 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
| Alignment Length: | 200 | Identity: | 50/200 - (25%) |
|---|---|---|---|
| Similarity: | 71/200 - (35%) | Gaps: | 40/200 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 599 DDNY---EIDANLVTEFIRQHTSPL------------------GSGRYICHLCSTEFRQFKGLQN 642
Fly 643 HMHSHTNWIRANCKKQPQCQI--CLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYR 705
Fly 706 HRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVERKHPEV-VDPL-FKCGECGSLYDNVDSLQLHV 767
Fly 768 ESTDH 772 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10321 | NP_001261124.1 | zf-AD | 12..80 | CDD:214871 | |
| ASF1_hist_chap | <405..516 | CDD:304562 | |||
| C2H2 Zn finger | 627..647 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 661..681 | CDD:275368 | 6/21 (29%) | ||
| C2H2 Zn finger | 690..710 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 717..740 | CDD:275368 | 7/22 (32%) | ||
| C2H2 Zn finger | 750..767 | CDD:275368 | 3/16 (19%) | ||
| CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | |
| C2H2 Zn finger | 144..164 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 186..211 | CDD:290200 | 8/25 (32%) | ||
| UFD2 | <256..>294 | CDD:227443 | 5/24 (21%) | ||
| C2H2 Zn finger | 258..280 | CDD:275368 | 5/21 (24%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||