Sequence 1: | NP_001261124.1 | Gene: | CG10321 / 37464 | FlyBaseID: | FBgn0034643 | Length: | 855 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 50/200 - (25%) |
---|---|---|---|
Similarity: | 71/200 - (35%) | Gaps: | 40/200 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 599 DDNY---EIDANLVTEFIRQHTSPL------------------GSGRYICHLCSTEFRQFKGLQN 642
Fly 643 HMHSHTNWIRANCKKQPQCQI--CLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYR 705
Fly 706 HRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVERKHPEV-VDPL-FKCGECGSLYDNVDSLQLHV 767
Fly 768 ESTDH 772 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10321 | NP_001261124.1 | zf-AD | 12..80 | CDD:214871 | |
ASF1_hist_chap | <405..516 | CDD:304562 | |||
C2H2 Zn finger | 627..647 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 661..681 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 690..710 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 717..740 | CDD:275368 | 7/22 (32%) | ||
C2H2 Zn finger | 750..767 | CDD:275368 | 3/16 (19%) | ||
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | |
C2H2 Zn finger | 144..164 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 8/25 (32%) | ||
UFD2 | <256..>294 | CDD:227443 | 5/24 (21%) | ||
C2H2 Zn finger | 258..280 | CDD:275368 | 5/21 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |