DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and M1BP

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:535 Identity:109/535 - (20%)
Similarity:179/535 - (33%) Gaps:196/535 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QSTTNGQATAAQSQFLPQLLQTPNGQTLQIVQQPNGTQ---------------TLQLVQLV---- 297
            :||....|..|.::..|:|.:..|.:.:..::...|.:               :::|...|    
  Fly    10 KSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRE 74

  Fly   298 ----PQRSLAPTGVTT-----VTTTTNATDMGQHVGASLGDADVQLLEDGCEVEDEELEDVYEQL 353
                .||.|. .|:|.     ::....|..||:.:..::...|           |:|:...|:: 
  Fly    75 RCIAAQRELL-LGLTEEQRQGISAFYRAAVMGEDIVQTVKTPD-----------DDEVYATYQE- 126

  Fly   354 DSKADHSFETIVLD------DDQQQDFLKDHHEHHQVMINEDLTQSESQDHEYFDDLDQQQAMDE 412
                      |||:      ||.:.::...::|..:....||...|..::.:|          |.
  Fly   127 ----------IVLEEPKEEIDDTKVEYDNTYYEVAEGHAGEDDAASLIEEADY----------DS 171

  Fly   413 I--EDEEEQMKPEEDQDTFIIEEIQLEDDEMLDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEY 475
            |  ||||:|...|.|:||.:|                                  .|||:|...|
  Fly   172 IMAEDEEQQQTLELDEDTELI----------------------------------VGDVNDAYVY 202

  Fly   476 SIMEPPDGETSVDIDQAFMDSEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVSSA 540
                  |.:..|.:....:|.|..|             ||.||:                 ..|.
  Fly   203 ------DSDDEVAVLDNVLDDEYEH-------------ENIVVK-----------------KCSL 231

  Fly   541 SPTPK-RAKRSNHQIPAGVTL-EPCDHQPPAAGSTTSSKLAAANSRQLVQTASVIAAAGADDNYE 603
            .|.|| |:..:..:...||.: |.|       |:....::|                      :|
  Fly   232 PPKPKVRSDDARRRGTGGVYICEQC-------GNHIKGRMA----------------------FE 267

  Fly   604 IDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQP-QCQICLKS 667
            :..       |:|.   |..::.|.||.:.|.....|:.||..||.       ::| .|:.|.:.
  Fly   268 LHC-------RRHR---GDKQFGCELCQSRFCTTSELKRHMRKHTG-------ERPFACKYCGRC 315

  Fly   668 FKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QRAYCCGVANCRKNFSSAVN 731
            |........|.:||..|... :|..|.:.|.:..||..|...|. :|||.|.:  |.|:|....:
  Fly   316 FTDYTTRVKHERTHTNERPY-VCGTCGKAFTTGYILKNHMLIHSGERAYRCEL--CDKSFMLPTH 377

  Fly   732 LKWH----VERKHPE 742
            |..|    |.::|.|
  Fly   378 LSTHFRSGVHKRHLE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 23/112 (21%)
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 4/19 (21%)
C2H2 Zn finger 690..710 CDD:275368 6/19 (32%)
C2H2 Zn finger 717..740 CDD:275368 7/26 (27%)
C2H2 Zn finger 750..767 CDD:275368
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 10/70 (14%)
C2H2 Zn finger 253..273 CDD:275368 6/55 (11%)
COG5048 276..>331 CDD:227381 16/61 (26%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 293..317 CDD:290200 8/30 (27%)
C2H2 Zn finger 309..329 CDD:275368 4/19 (21%)
zf-H2C2_2 324..346 CDD:290200 7/22 (32%)
C2H2 Zn finger 337..357 CDD:275368 6/19 (32%)
zf-H2C2_2 350..372 CDD:290200 9/23 (39%)
C2H2 Zn finger 365..383 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.